BLASTX nr result
ID: Coptis21_contig00040388
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00040388 (240 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003598679.1| F-box family protein [Medicago truncatula] g... 56 3e-06 >ref|XP_003598679.1| F-box family protein [Medicago truncatula] gi|355487727|gb|AES68930.1| F-box family protein [Medicago truncatula] Length = 361 Score = 55.8 bits (133), Expect = 3e-06 Identities = 26/38 (68%), Positives = 31/38 (81%) Frame = -3 Query: 115 QNNEDRLSSLPDNILHKILDLLDTLYAVRSSILSKRWR 2 +NNEDRLS LPD+ILH IL LLDT A ++SILS RW+ Sbjct: 21 ENNEDRLSDLPDSILHHILSLLDTKQAFQTSILSTRWK 58