BLASTX nr result
ID: Coptis21_contig00040338
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00040338 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI36804.3| unnamed protein product [Vitis vinifera] 60 2e-07 ref|XP_002535702.1| hypothetical protein RCOM_2112970 [Ricinus c... 59 4e-07 >emb|CBI36804.3| unnamed protein product [Vitis vinifera] Length = 1732 Score = 59.7 bits (143), Expect = 2e-07 Identities = 35/64 (54%), Positives = 41/64 (64%), Gaps = 2/64 (3%) Frame = +2 Query: 98 KHDDDAESSEARHKLLEIVPADKTFNV--IGSSDPKGIDTEALGLLRWLASSQAAEDLNT 271 + DDDA SE R L+ + D+ IG S K D EALGLL WLASSQAAED+N+ Sbjct: 384 EEDDDAIPSEGRGMCLQQLSVDERQRSENIGPSGLKVADNEALGLLSWLASSQAAEDINS 443 Query: 272 DDEL 283 DDEL Sbjct: 444 DDEL 447 >ref|XP_002535702.1| hypothetical protein RCOM_2112970 [Ricinus communis] gi|223522232|gb|EEF26681.1| hypothetical protein RCOM_2112970 [Ricinus communis] Length = 459 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/35 (77%), Positives = 31/35 (88%) Frame = +2 Query: 179 IGSSDPKGIDTEALGLLRWLASSQAAEDLNTDDEL 283 IG+ DPK D EALGLLRWLA+SQAAED+N+DDEL Sbjct: 145 IGTLDPKAADKEALGLLRWLATSQAAEDINSDDEL 179