BLASTX nr result
ID: Coptis21_contig00040261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00040261 (410 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002534404.1| conserved hypothetical protein [Ricinus comm... 60 1e-07 >ref|XP_002534404.1| conserved hypothetical protein [Ricinus communis] gi|223525361|gb|EEF27982.1| conserved hypothetical protein [Ricinus communis] Length = 181 Score = 60.5 bits (145), Expect = 1e-07 Identities = 32/73 (43%), Positives = 43/73 (58%), Gaps = 2/73 (2%) Frame = +1 Query: 184 RICKPWTNCLNGKIFGRKVSVKHL--M*KME*KTLFSIILLLLDNDYFIPKLSMKDDLDY 357 R+ K W L K+ GR + +L + K K SI L+ LDND++I KLS K+D D+ Sbjct: 71 RMRKSWKQTLIIKLLGRSIGHNYLFRIVKELWKAKGSIDLVALDNDFYIAKLSFKNDYDF 130 Query: 358 VLTEGPWFIADHY 396 L EGPW + DHY Sbjct: 131 ALFEGPWMVVDHY 143