BLASTX nr result
ID: Coptis21_contig00039138
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00039138 (301 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW90627.1| hypothetical protein [Solanum tuberosum] 56 3e-06 >gb|AFW90627.1| hypothetical protein [Solanum tuberosum] Length = 248 Score = 55.8 bits (133), Expect = 3e-06 Identities = 29/68 (42%), Positives = 41/68 (60%), Gaps = 3/68 (4%) Frame = +3 Query: 105 ISKVVLSGNPLLTTDYVVMAICEGSWALTFYKPGNNAWTSI---GSECPLVNDIIYYRDQ 275 I K VLS +P T+DY++M I GS L+F++PG+ WT + G D+IY+ Q Sbjct: 138 IGKAVLSASPSHTSDYLLMVIDGGSRFLSFWRPGDIRWTRVTWEGINYSSFADLIYFNGQ 197 Query: 276 FYAVDFYG 299 YAVD+ G Sbjct: 198 IYAVDYSG 205