BLASTX nr result
ID: Coptis21_contig00039013
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00039013 (444 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002532555.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 ref|XP_002518340.1| conserved hypothetical protein [Ricinus comm... 58 7e-07 >ref|XP_002532555.1| conserved hypothetical protein [Ricinus communis] gi|223527710|gb|EEF29816.1| conserved hypothetical protein [Ricinus communis] Length = 690 Score = 61.6 bits (148), Expect = 6e-08 Identities = 41/136 (30%), Positives = 72/136 (52%), Gaps = 4/136 (2%) Frame = -1 Query: 399 NGTIYAFT-ASNNVLATIDREGCGTMSIRWFQIESPRHYS--EAHFFWPYMVESYGEIYS 229 NG +Y F+ +N+ + +D G + +R +E S E+ F VE+ GEIY Sbjct: 163 NGKLYVFSYLTNSAIFVLDEINKGGVVLRSLNVEYQNIMSQLESLNFRRCFVEASGEIYG 222 Query: 228 VFLHHIGEHDPLKYVEIFKMDFTKMAWVTVESLGETVFFLSQYGNMSLSVANSGIKGNTI 49 + + G + +E+ K+DF++MAW VE + ++V FL + ++S I+GN + Sbjct: 223 INILLGGYDSRVVDIEVRKIDFSRMAWEKVECVKDSVLFLDDHYSISCPEIRPEIQGNRL 282 Query: 48 HFVEK-NSLYVFGVGD 4 +FV K + LY + + D Sbjct: 283 YFVLKDHKLYSYSIED 298 >ref|XP_002518340.1| conserved hypothetical protein [Ricinus communis] gi|223542560|gb|EEF44100.1| conserved hypothetical protein [Ricinus communis] Length = 377 Score = 58.2 bits (139), Expect = 7e-07 Identities = 28/76 (36%), Positives = 45/76 (59%) Frame = -1 Query: 270 FWPYMVESYGEIYSVFLHHIGEHDPLKYVEIFKMDFTKMAWVTVESLGETVFFLSQYGNM 91 F ++VES G + VFL + + YVE+++++ K+AW+ ESLGE FL M Sbjct: 265 FKEFLVESEGMVLLVFLISRNSINTVDYVEVYQLNTAKLAWIKKESLGERTLFLGSNCCM 324 Query: 90 SLSVANSGIKGNTIHF 43 S+S + G +GN ++F Sbjct: 325 SVSASRVGCRGNCVYF 340