BLASTX nr result
ID: Coptis21_contig00038964
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00038964 (286 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002331406.1| predicted protein [Populus trichocarpa] gi|2... 63 2e-08 ref|XP_002310352.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 ref|XP_002330454.1| predicted protein [Populus trichocarpa] gi|2... 55 6e-06 >ref|XP_002331406.1| predicted protein [Populus trichocarpa] gi|222873620|gb|EEF10751.1| predicted protein [Populus trichocarpa] Length = 671 Score = 63.2 bits (152), Expect = 2e-08 Identities = 36/93 (38%), Positives = 56/93 (60%), Gaps = 1/93 (1%) Frame = +2 Query: 11 PVRAPLQPFMASNRPHMPWSLALLIVLVCVVSASGASEIDILMKFKKALVGAEVPLRDWN 190 PVR PL + ++ + L L+V + V++ G ++ +IL+KFK +L A V L DW+ Sbjct: 8 PVRVPLLYSIVTSNHKTSFVLVFLLVSLHFVASLGLTDSEILLKFKGSLTNASV-LSDWS 66 Query: 191 PSVVPCT-NTTSNWGTTVICRDSTVYGLQLESM 286 PCT N +NW VIC + +++GLQLE+M Sbjct: 67 DKTTPCTKNNATNW-VGVICVEGSLWGLQLENM 98 >ref|XP_002310352.1| predicted protein [Populus trichocarpa] gi|222853255|gb|EEE90802.1| predicted protein [Populus trichocarpa] Length = 625 Score = 57.0 bits (136), Expect = 2e-06 Identities = 32/72 (44%), Positives = 44/72 (61%) Frame = +2 Query: 71 LALLIVLVCVVSASGASEIDILMKFKKALVGAEVPLRDWNPSVVPCTNTTSNWGTTVICR 250 L L VL VV++ G+ + D L+KFK+ LV E + +WN SV PC SNW V+C Sbjct: 19 LVLAFVLSIVVTSFGSPDSDALLKFKEQLVNNE-GISNWNVSVNPCERDRSNW-VGVLCF 76 Query: 251 DSTVYGLQLESM 286 + ++GLQLE M Sbjct: 77 NGGIWGLQLEHM 88 >ref|XP_002330454.1| predicted protein [Populus trichocarpa] gi|222871866|gb|EEF08997.1| predicted protein [Populus trichocarpa] Length = 653 Score = 55.1 bits (131), Expect = 6e-06 Identities = 31/72 (43%), Positives = 41/72 (56%) Frame = +2 Query: 71 LALLIVLVCVVSASGASEIDILMKFKKALVGAEVPLRDWNPSVVPCTNTTSNWGTTVICR 250 L L VL VV++ G+ + D L+KFK L + WNPSV PC SNW V+C Sbjct: 20 LVLAFVLSIVVTSFGSPDSDALLKFKDQLANNGA-INSWNPSVKPCEWERSNW-VGVLCL 77 Query: 251 DSTVYGLQLESM 286 + ++ GLQLE M Sbjct: 78 NGSIRGLQLEHM 89