BLASTX nr result
ID: Coptis21_contig00038944
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00038944 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004163107.1| PREDICTED: valine--tRNA ligase-like [Cucumis... 58 9e-07 ref|XP_004143624.1| PREDICTED: valine--tRNA ligase-like [Cucumis... 58 9e-07 >ref|XP_004163107.1| PREDICTED: valine--tRNA ligase-like [Cucumis sativus] Length = 1045 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +2 Query: 128 ALQKQLHASSSTSNKSEKKGARRWGGEEENAEDFLDPPTPLGKKK 262 AL+ Q +S+ KSEKK ARR GG+EENAEDF+DP TP GKKK Sbjct: 36 ALKLQAQQTSNAPKKSEKKNARR-GGDEENAEDFVDPDTPFGKKK 79 >ref|XP_004143624.1| PREDICTED: valine--tRNA ligase-like [Cucumis sativus] Length = 1045 Score = 57.8 bits (138), Expect = 9e-07 Identities = 29/45 (64%), Positives = 34/45 (75%) Frame = +2 Query: 128 ALQKQLHASSSTSNKSEKKGARRWGGEEENAEDFLDPPTPLGKKK 262 AL+ Q +S+ KSEKK ARR GG+EENAEDF+DP TP GKKK Sbjct: 36 ALKLQAQQTSNAPKKSEKKNARR-GGDEENAEDFVDPDTPFGKKK 79