BLASTX nr result
ID: Coptis21_contig00038535
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00038535 (283 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|NP_001030688.1| TATA-box-binding protein 1 [Arabidopsis thal... 82 4e-14 ref|NP_187953.1| TATA-box-binding protein 1 [Arabidopsis thalian... 82 4e-14 ref|XP_002882826.1| transcription factor IID-1 [Arabidopsis lyra... 81 1e-13 sp|P26357.1|TBP_SOLTU RecName: Full=TATA-box-binding protein; Al... 80 1e-13 gb|ACJ86114.1| unknown [Medicago truncatula] 80 1e-13 >ref|NP_001030688.1| TATA-box-binding protein 1 [Arabidopsis thaliana] gi|332641835|gb|AEE75356.1| TATA-box-binding protein 1 [Arabidopsis thaliana] Length = 196 Score = 82.0 bits (201), Expect = 4e-14 Identities = 39/54 (72%), Positives = 45/54 (83%) Frame = +1 Query: 16 MSDHNLAKTHPVDLSVHPSGVVPEVQNIVSTVDLDCKLDLKKIVLQACNAEYNP 177 M+D L ++PVDLS HPSG+VP +QNIVSTV+LDCKLDLK I LQA NAEYNP Sbjct: 1 MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNP 54 >ref|NP_187953.1| TATA-box-binding protein 1 [Arabidopsis thaliana] gi|135626|sp|P28147.1|TBP1_ARATH RecName: Full=TATA-box-binding protein 1; AltName: Full=TATA sequence-binding protein 1; Short=TBP-1; AltName: Full=TATA-binding factor 1; AltName: Full=TATA-box factor 1; AltName: Full=Transcription initiation factor TFIID TBP-1 subunit gi|1943466|pdb|1VOK|A Chain A, Arabidopsis Thaliana Tbp (Dimer) gi|1943467|pdb|1VOK|B Chain B, Arabidopsis Thaliana Tbp (Dimer) gi|1943469|pdb|1VOL|B Chain B, Tfiib (Human Core Domain)TBP (A.THALIANA)TATA ELEMENT Ternary Complex gi|7245860|pdb|1QN5|A Chain A, Crystal Structure Of The G(-26) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245861|pdb|1QN5|B Chain B, Crystal Structure Of The G(-26) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245866|pdb|1QN6|A Chain A, Crystal Structure Of The T(-26) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245867|pdb|1QN6|B Chain B, Crystal Structure Of The T(-26) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245872|pdb|1QN7|A Chain A, Crystal Structure Of The T(-27) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245873|pdb|1QN7|B Chain B, Crystal Structure Of The T(-27) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245878|pdb|1QN8|A Chain A, Crystal Structure Of The T(-28) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245879|pdb|1QN8|B Chain B, Crystal Structure Of The T(-28) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245884|pdb|1QN9|A Chain A, Crystal Structure Of The C(-29) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245885|pdb|1QN9|B Chain B, Crystal Structure Of The C(-29) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245890|pdb|1QNA|A Chain A, Crystal Structure Of The T(-30) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245891|pdb|1QNA|B Chain B, Crystal Structure Of The T(-30) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245896|pdb|1QNB|A Chain A, Crystal Structure Of The T(-25) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245897|pdb|1QNB|B Chain B, Crystal Structure Of The T(-25) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245902|pdb|1QNC|A Chain A, Crystal Structure Of The A(-31) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245903|pdb|1QNC|B Chain B, Crystal Structure Of The A(-31) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245908|pdb|1QNE|A Chain A, Crystal Structure Of The Adenovirus Major Late Promoter Tata Box Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). gi|7245909|pdb|1QNE|B Chain B, Crystal Structure Of The Adenovirus Major Late Promoter Tata Box Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). gi|7245938|pdb|1QN3|A Chain A, Crystal Structure Of The C(-25) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7245939|pdb|1QN3|B Chain B, Crystal Structure Of The C(-25) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7246010|pdb|1QN4|A Chain A, Crystal Structure Of The T(-24) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|7246011|pdb|1QN4|B Chain B, Crystal Structure Of The T(-24) Adenovirus Major Late Promoter Tata Box Variant Bound To Wild-Type Tbp (Arabidopsis Thaliana Tbp Isoform 2). Tata Element Recognition By The Tata Box-Binding Protein Has Been Conserved Throughout Evolution. gi|11692888|gb|AAG40047.1|AF324696_1 AT3g13445 [Arabidopsis thaliana] gi|11935207|gb|AAG42019.1|AF327429_1 putative transcription initiation factor TFIID-1 [Arabidopsis thaliana] gi|13194816|gb|AAK15570.1|AF349523_1 putative TATA sequence-binding transcription initiation factor protein [Arabidopsis thaliana] gi|16548|emb|CAA38743.1| transcription initiation factor II [Arabidopsis thaliana] gi|9280296|dbj|BAB01751.1| transcription initiation factor TFIID-1 (TATA-box factor 1) (TATA sequence-binding protein 1) (TBP-1) [Arabidopsis thaliana] gi|15451056|gb|AAK96799.1| transcription initiation factor TFIID-1 (TATA-box factor 1) (TATA sequence-binding protein 1) (TBP-1) [Arabidopsis thaliana] gi|18377408|gb|AAL66870.1| transcription initiation factor TFIID-1 [Arabidopsis thaliana] gi|21537103|gb|AAM61444.1| transcription initiation factor TFIID-1 (TATA sequence-binding protein 1) [Arabidopsis thaliana] gi|39545928|gb|AAR28027.1| TBP1 [Arabidopsis thaliana] gi|225898637|dbj|BAH30449.1| hypothetical protein [Arabidopsis thaliana] gi|332641834|gb|AEE75355.1| TATA-box-binding protein 1 [Arabidopsis thaliana] gi|227074|prf||1613452B transcription initiation factor TFIID-2 Length = 200 Score = 82.0 bits (201), Expect = 4e-14 Identities = 39/54 (72%), Positives = 45/54 (83%) Frame = +1 Query: 16 MSDHNLAKTHPVDLSVHPSGVVPEVQNIVSTVDLDCKLDLKKIVLQACNAEYNP 177 M+D L ++PVDLS HPSG+VP +QNIVSTV+LDCKLDLK I LQA NAEYNP Sbjct: 1 MTDQGLEGSNPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNP 54 >ref|XP_002882826.1| transcription factor IID-1 [Arabidopsis lyrata subsp. lyrata] gi|297328666|gb|EFH59085.1| transcription factor IID-1 [Arabidopsis lyrata subsp. lyrata] Length = 200 Score = 80.9 bits (198), Expect = 1e-13 Identities = 39/54 (72%), Positives = 44/54 (81%) Frame = +1 Query: 16 MSDHNLAKTHPVDLSVHPSGVVPEVQNIVSTVDLDCKLDLKKIVLQACNAEYNP 177 M+D L + PVDLS HPSG+VP +QNIVSTV+LDCKLDLK I LQA NAEYNP Sbjct: 1 MADQGLEGSTPVDLSKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNP 54 >sp|P26357.1|TBP_SOLTU RecName: Full=TATA-box-binding protein; AltName: Full=TATA sequence-binding protein; Short=TBP; AltName: Full=TATA-binding factor; AltName: Full=TATA-box factor; AltName: Full=Transcription initiation factor TFIID TBP subunit gi|21581|emb|CAA44360.1| TATA-binding protein [Solanum tuberosum] Length = 200 Score = 80.5 bits (197), Expect = 1e-13 Identities = 38/54 (70%), Positives = 44/54 (81%) Frame = +1 Query: 16 MSDHNLAKTHPVDLSVHPSGVVPEVQNIVSTVDLDCKLDLKKIVLQACNAEYNP 177 M+D L + PVDL+ HPSG+VP +QNIVSTV+LDCKLDLK I LQA NAEYNP Sbjct: 1 MADQGLEGSQPVDLTKHPSGIVPTLQNIVSTVNLDCKLDLKAIALQARNAEYNP 54 >gb|ACJ86114.1| unknown [Medicago truncatula] Length = 200 Score = 80.5 bits (197), Expect = 1e-13 Identities = 38/54 (70%), Positives = 44/54 (81%) Frame = +1 Query: 16 MSDHNLAKTHPVDLSVHPSGVVPEVQNIVSTVDLDCKLDLKKIVLQACNAEYNP 177 M+D L + PVDLS HPSG+VP +QNIVSTV+LDCKL+LK I LQA NAEYNP Sbjct: 1 MADQGLEGSQPVDLSKHPSGIVPTLQNIVSTVNLDCKLELKSIALQARNAEYNP 54