BLASTX nr result
ID: Coptis21_contig00038533
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00038533 (241 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI37492.3| unnamed protein product [Vitis vinifera] 55 5e-06 >emb|CBI37492.3| unnamed protein product [Vitis vinifera] Length = 418 Score = 55.5 bits (132), Expect = 5e-06 Identities = 27/66 (40%), Positives = 40/66 (60%) Frame = -3 Query: 200 SRETSELFSESCKEALLPSRDLSVDKESQYRIAISYATPRENEKVPIFVKFKQNLKMLDE 21 S ET E+ SE C EALLPS+D +E + +++A +KVP K KQ +++L E Sbjct: 190 SGETLEILSEGCTEALLPSKDCPSSRECSDEVELAHAGSEGKQKVPFLEKIKQQVEILME 249 Query: 20 RFNLKK 3 + +LKK Sbjct: 250 KIDLKK 255