BLASTX nr result
ID: Coptis21_contig00038208
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00038208 (513 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510588.1| Alpha-expansin 11 precursor, putative [Ricin... 66 3e-09 gb|AET25522.1| expansin [Chimonanthus praecox] 65 6e-09 ref|XP_002300688.1| hypothetical protein POPTRDRAFT_709919 [Popu... 60 2e-07 gb|ACK36944.1| expansin [Annona cherimola] 60 2e-07 ref|XP_003544384.1| PREDICTED: expansin-A11-like, partial [Glyci... 59 4e-07 >ref|XP_002510588.1| Alpha-expansin 11 precursor, putative [Ricinus communis] gi|223551289|gb|EEF52775.1| Alpha-expansin 11 precursor, putative [Ricinus communis] Length = 256 Score = 66.2 bits (160), Expect = 3e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 1 SLSFKVITTDGETRFFPNIVPSGWQFGQTFSSQVQF 108 SLSFK+ TTDG TRFFPN+VPS W FGQTFSS VQF Sbjct: 221 SLSFKITTTDGATRFFPNVVPSNWAFGQTFSSSVQF 256 >gb|AET25522.1| expansin [Chimonanthus praecox] Length = 256 Score = 65.1 bits (157), Expect = 6e-09 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = +1 Query: 1 SLSFKVITTDGETRFFPNIVPSGWQFGQTFSSQVQF 108 SLSFK+ TTDGETR FP+IVPS W FGQTFSS VQF Sbjct: 221 SLSFKITTTDGETRLFPDIVPSSWHFGQTFSSSVQF 256 >ref|XP_002300688.1| hypothetical protein POPTRDRAFT_709919 [Populus trichocarpa] gi|222842414|gb|EEE79961.1| hypothetical protein POPTRDRAFT_709919 [Populus trichocarpa] Length = 256 Score = 60.1 bits (144), Expect = 2e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 SLSFKVITTDGETRFFPNIVPSGWQFGQTFSSQVQF 108 SLSFKV TTDG+TRFF +IVP+ W FGQTF S VQF Sbjct: 221 SLSFKVTTTDGQTRFFTDIVPANWGFGQTFQSSVQF 256 >gb|ACK36944.1| expansin [Annona cherimola] Length = 256 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 SLSFKVITTDGETRFFPNIVPSGWQFGQTFSSQVQF 108 SLSFK T DGETR FP+IVPS W+FGQ+FSS VQF Sbjct: 221 SLSFKATTGDGETRIFPDIVPSSWKFGQSFSSTVQF 256 >ref|XP_003544384.1| PREDICTED: expansin-A11-like, partial [Glycine max] Length = 178 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = +1 Query: 1 SLSFKVITTDGETRFFPNIVPSGWQFGQTFSSQVQF 108 SLSF+V TTDGETR F +IVP+ W FGQTFSS VQF Sbjct: 143 SLSFRVTTTDGETRVFQDIVPASWTFGQTFSSPVQF 178