BLASTX nr result
ID: Coptis21_contig00037381
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00037381 (479 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002274010.1| PREDICTED: cellulose synthase-like protein D... 72 8e-24 emb|CAN62994.1| hypothetical protein VITISV_021619 [Vitis vinifera] 72 9e-24 ref|XP_002892121.1| hypothetical protein ARALYDRAFT_887416 [Arab... 75 1e-23 ref|NP_171773.1| 1,4-beta-D-xylan synthase [Arabidopsis thaliana... 75 1e-23 ref|XP_003521583.1| PREDICTED: cellulose synthase-like protein D... 74 2e-22 >ref|XP_002274010.1| PREDICTED: cellulose synthase-like protein D5-like [Vitis vinifera] Length = 1171 Score = 72.4 bits (176), Expect(2) = 8e-24 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 477 FPQWSKLVGGVFFSFWVLCHLYPFAKGLMRRR 382 FPQWSKLVGGVFFSFWVLCHLYPFAKGLM RR Sbjct: 1100 FPQWSKLVGGVFFSFWVLCHLYPFAKGLMGRR 1131 Score = 62.8 bits (151), Expect(2) = 8e-24 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 368 TVVCVCSGLLSIVISLLWVYISPPSGRQDYMTLSFP 261 T+V V SGLLSI+ISLLWVYISPPSGRQDYM FP Sbjct: 1136 TIVFVWSGLLSIIISLLWVYISPPSGRQDYMKFQFP 1171 >emb|CAN62994.1| hypothetical protein VITISV_021619 [Vitis vinifera] Length = 409 Score = 72.4 bits (176), Expect(2) = 9e-24 Identities = 31/32 (96%), Positives = 31/32 (96%) Frame = -3 Query: 477 FPQWSKLVGGVFFSFWVLCHLYPFAKGLMRRR 382 FPQWSKLVGGVFFSFWVLCHLYPFAKGLM RR Sbjct: 338 FPQWSKLVGGVFFSFWVLCHLYPFAKGLMGRR 369 Score = 62.8 bits (151), Expect(2) = 9e-24 Identities = 29/36 (80%), Positives = 31/36 (86%) Frame = -1 Query: 368 TVVCVCSGLLSIVISLLWVYISPPSGRQDYMTLSFP 261 T+V V SGLLSI+ISLLWVYISPPSGRQDYM FP Sbjct: 374 TIVFVWSGLLSIIISLLWVYISPPSGRQDYMKFQFP 409 >ref|XP_002892121.1| hypothetical protein ARALYDRAFT_887416 [Arabidopsis lyrata subsp. lyrata] gi|297337963|gb|EFH68380.1| hypothetical protein ARALYDRAFT_887416 [Arabidopsis lyrata subsp. lyrata] Length = 1184 Score = 74.7 bits (182), Expect(2) = 1e-23 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 477 FPQWSKLVGGVFFSFWVLCHLYPFAKGLMRRRG 379 FPQWSKLVGGVFFSFWVLCHLYPFAKGLM RRG Sbjct: 1113 FPQWSKLVGGVFFSFWVLCHLYPFAKGLMGRRG 1145 Score = 60.1 bits (144), Expect(2) = 1e-23 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -1 Query: 368 TVVCVCSGLLSIVISLLWVYISPPSGRQDYMTLSFP 261 T+V V SGLLSI++SLLWVYI+PPSG+QDYM FP Sbjct: 1149 TIVFVWSGLLSIIVSLLWVYINPPSGKQDYMQFQFP 1184 >ref|NP_171773.1| 1,4-beta-D-xylan synthase [Arabidopsis thaliana] gi|75207418|sp|Q9SRW9.1|CSLD5_ARATH RecName: Full=Cellulose synthase-like protein D5; Short=AtCslD5 gi|6056428|gb|AAF02892.1|AC009525_26 Very similar to cellulose synthase catalytic subunit [Arabidopsis thaliana] gi|332189343|gb|AEE27464.1| 1,4-beta-D-xylan synthase [Arabidopsis thaliana] Length = 1181 Score = 74.7 bits (182), Expect(2) = 1e-23 Identities = 32/33 (96%), Positives = 32/33 (96%) Frame = -3 Query: 477 FPQWSKLVGGVFFSFWVLCHLYPFAKGLMRRRG 379 FPQWSKLVGGVFFSFWVLCHLYPFAKGLM RRG Sbjct: 1110 FPQWSKLVGGVFFSFWVLCHLYPFAKGLMGRRG 1142 Score = 60.1 bits (144), Expect(2) = 1e-23 Identities = 26/36 (72%), Positives = 31/36 (86%) Frame = -1 Query: 368 TVVCVCSGLLSIVISLLWVYISPPSGRQDYMTLSFP 261 T+V V SGLLSI++SLLWVYI+PPSG+QDYM FP Sbjct: 1146 TIVFVWSGLLSIIVSLLWVYINPPSGKQDYMQFQFP 1181 >ref|XP_003521583.1| PREDICTED: cellulose synthase-like protein D5-like [Glycine max] Length = 1151 Score = 73.6 bits (179), Expect(2) = 2e-22 Identities = 31/33 (93%), Positives = 32/33 (96%) Frame = -3 Query: 477 FPQWSKLVGGVFFSFWVLCHLYPFAKGLMRRRG 379 FPQWS+LVGGVFFSFWVLCHLYPFAKGLM RRG Sbjct: 1079 FPQWSRLVGGVFFSFWVLCHLYPFAKGLMGRRG 1111 Score = 57.0 bits (136), Expect(2) = 2e-22 Identities = 27/37 (72%), Positives = 31/37 (83%), Gaps = 1/37 (2%) Frame = -1 Query: 368 TVVCVCSGLLSIVISLLWVYISPPSGR-QDYMTLSFP 261 T++ V SGLLSI+ISLLWVYI+PPSGR QDYM FP Sbjct: 1115 TIIYVWSGLLSIIISLLWVYINPPSGRTQDYMNFQFP 1151