BLASTX nr result
ID: Coptis21_contig00037137
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00037137 (259 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002512201.1| lipid binding protein, putative [Ricinus com... 82 6e-14 ref|XP_002270671.1| PREDICTED: uncharacterized GPI-anchored prot... 81 8e-14 emb|CAN59826.1| hypothetical protein VITISV_016657 [Vitis vinifera] 81 8e-14 ref|NP_001240276.1| uncharacterized protein LOC100792950 precurs... 80 1e-13 gb|ACU15623.1| unknown [Glycine max] 80 1e-13 >ref|XP_002512201.1| lipid binding protein, putative [Ricinus communis] gi|223548745|gb|EEF50235.1| lipid binding protein, putative [Ricinus communis] Length = 133 Score = 81.6 bits (200), Expect = 6e-14 Identities = 34/53 (64%), Positives = 42/53 (79%) Frame = +3 Query: 99 YARCDDQKQREECSQQLIGLATCLDYVGGQAKAPTPDCCKGMKTVLAKSKKCL 257 +A D K +EEC++QL+GLATCL YVGG AK+PTPDCC G+K VL +KKCL Sbjct: 4 FAMADADKDKEECAEQLVGLATCLPYVGGNAKSPTPDCCTGLKEVLKNNKKCL 56 >ref|XP_002270671.1| PREDICTED: uncharacterized GPI-anchored protein At1g27950 [Vitis vinifera] gi|297741205|emb|CBI32156.3| unnamed protein product [Vitis vinifera] Length = 188 Score = 81.3 bits (199), Expect = 8e-14 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +3 Query: 111 DDQKQREECSQQLIGLATCLDYVGGQAKAPTPDCCKGMKTVLAKSKKCL 257 D K ++EC++QL+G+ATCL YVGG AKAPTPDCC G+K VL K+KKCL Sbjct: 23 DSAKDKQECTEQLVGMATCLPYVGGDAKAPTPDCCSGLKQVLQKNKKCL 71 >emb|CAN59826.1| hypothetical protein VITISV_016657 [Vitis vinifera] Length = 595 Score = 81.3 bits (199), Expect = 8e-14 Identities = 33/49 (67%), Positives = 41/49 (83%) Frame = +3 Query: 111 DDQKQREECSQQLIGLATCLDYVGGQAKAPTPDCCKGMKTVLAKSKKCL 257 D K ++EC++QL+G+ATCL YVGG AKAPTPDCC G+K VL K+KKCL Sbjct: 23 DSAKDKQECTEQLVGMATCLPYVGGDAKAPTPDCCSGLKQVLQKNKKCL 71 >ref|NP_001240276.1| uncharacterized protein LOC100792950 precursor [Glycine max] gi|255647200|gb|ACU24068.1| unknown [Glycine max] Length = 195 Score = 80.5 bits (197), Expect = 1e-13 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = +3 Query: 111 DDQKQREECSQQLIGLATCLDYVGGQAKAPTPDCCKGMKTVLAKSKKCL 257 D K +EEC++QL GLATCL YVGGQA+APTPDCC G+K VL +KKCL Sbjct: 26 DSSKDKEECTEQLAGLATCLPYVGGQAQAPTPDCCSGLKQVLKNNKKCL 74 >gb|ACU15623.1| unknown [Glycine max] Length = 193 Score = 80.5 bits (197), Expect = 1e-13 Identities = 34/49 (69%), Positives = 40/49 (81%) Frame = +3 Query: 111 DDQKQREECSQQLIGLATCLDYVGGQAKAPTPDCCKGMKTVLAKSKKCL 257 D K +EEC++QL GLATCL YVGGQA+APTPDCC G+K VL +KKCL Sbjct: 26 DSSKDKEECTEQLAGLATCLPYVGGQAQAPTPDCCSGLKQVLKNNKKCL 74