BLASTX nr result
ID: Coptis21_contig00036006
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00036006 (461 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004142134.1| PREDICTED: uncharacterized protein LOC101208... 47 2e-06 >ref|XP_004142134.1| PREDICTED: uncharacterized protein LOC101208797 [Cucumis sativus] gi|449520807|ref|XP_004167424.1| PREDICTED: uncharacterized protein LOC101232056 [Cucumis sativus] Length = 572 Score = 46.6 bits (109), Expect(2) = 2e-06 Identities = 18/33 (54%), Positives = 21/33 (63%) Frame = -2 Query: 100 PFFTPSYEEEPVNGYQHIQFDYGNLSEYWDGFG 2 P FTPSYE+EP NGY + G SE WD +G Sbjct: 64 PVFTPSYEDEPTNGYHQVPMRIGTFSESWDEYG 96 Score = 29.6 bits (65), Expect(2) = 2e-06 Identities = 21/43 (48%), Positives = 25/43 (58%) Frame = -3 Query: 225 VELRALHASLMQSNNSPASLRHXXXXXXXXXXXXXXXSAQDYP 97 VELRALHA+LMQ +SP++LR SAQDYP Sbjct: 29 VELRALHAALMQ-GSSPSNLR------FPSPSPVSQFSAQDYP 64