BLASTX nr result
ID: Coptis21_contig00035855
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00035855 (288 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI40500.3| unnamed protein product [Vitis vinifera] 150 1e-34 ref|XP_002276948.1| PREDICTED: pentatricopeptide repeat-containi... 150 1e-34 emb|CAN82500.1| hypothetical protein VITISV_004914 [Vitis vinifera] 150 1e-34 ref|XP_002320193.1| predicted protein [Populus trichocarpa] gi|2... 149 2e-34 ref|XP_003637737.1| Pentatricopeptide repeat-containing protein ... 133 1e-29 >emb|CBI40500.3| unnamed protein product [Vitis vinifera] Length = 1133 Score = 150 bits (378), Expect = 1e-34 Identities = 69/94 (73%), Positives = 81/94 (86%) Frame = +2 Query: 2 VDLLGRGGYLDEAWYFIQTMPLEPDASVWGALLGSCRIHKNLDLAEIAAKYLFKLEPYNS 181 VDLLGR GYLDEAW I TMPL+PDA++WGALLGSCRIHKNL AE AAK LFKLEP NS Sbjct: 905 VDLLGRAGYLDEAWDLIHTMPLKPDATIWGALLGSCRIHKNLKFAETAAKNLFKLEPNNS 964 Query: 182 ANYLLMMNLYSAENRWEDVENLRDLMGVVGLKSK 283 ANY+LMMNLYS NRWED+++LR+LMG G++++ Sbjct: 965 ANYILMMNLYSIFNRWEDMDHLRELMGAAGVRNR 998 >ref|XP_002276948.1| PREDICTED: pentatricopeptide repeat-containing protein At4g01030, mitochondrial-like [Vitis vinifera] Length = 913 Score = 150 bits (378), Expect = 1e-34 Identities = 69/94 (73%), Positives = 81/94 (86%) Frame = +2 Query: 2 VDLLGRGGYLDEAWYFIQTMPLEPDASVWGALLGSCRIHKNLDLAEIAAKYLFKLEPYNS 181 VDLLGR GYLDEAW I TMPL+PDA++WGALLGSCRIHKNL AE AAK LFKLEP NS Sbjct: 685 VDLLGRAGYLDEAWDLIHTMPLKPDATIWGALLGSCRIHKNLKFAETAAKNLFKLEPNNS 744 Query: 182 ANYLLMMNLYSAENRWEDVENLRDLMGVVGLKSK 283 ANY+LMMNLYS NRWED+++LR+LMG G++++ Sbjct: 745 ANYILMMNLYSIFNRWEDMDHLRELMGAAGVRNR 778 >emb|CAN82500.1| hypothetical protein VITISV_004914 [Vitis vinifera] Length = 1408 Score = 150 bits (378), Expect = 1e-34 Identities = 69/94 (73%), Positives = 81/94 (86%) Frame = +2 Query: 2 VDLLGRGGYLDEAWYFIQTMPLEPDASVWGALLGSCRIHKNLDLAEIAAKYLFKLEPYNS 181 VDLLGR GYLDEAW I TMPL+PDA++WGALLGSCRIHKNL AE AAK LFKLEP NS Sbjct: 1180 VDLLGRAGYLDEAWDLIHTMPLKPDATIWGALLGSCRIHKNLXFAETAAKNLFKLEPNNS 1239 Query: 182 ANYLLMMNLYSAENRWEDVENLRDLMGVVGLKSK 283 ANY+LMMNLYS NRWED+++LR+LMG G++++ Sbjct: 1240 ANYILMMNLYSIFNRWEDMDHLRELMGAAGVRNR 1273 >ref|XP_002320193.1| predicted protein [Populus trichocarpa] gi|222860966|gb|EEE98508.1| predicted protein [Populus trichocarpa] Length = 498 Score = 149 bits (377), Expect = 2e-34 Identities = 67/93 (72%), Positives = 81/93 (87%) Frame = +2 Query: 5 DLLGRGGYLDEAWYFIQTMPLEPDASVWGALLGSCRIHKNLDLAEIAAKYLFKLEPYNSA 184 DLLGR GYLDEAW FIQTMP++PDASVWGA+LGSCRIH N++ AEIAAK LFKLEPYNSA Sbjct: 272 DLLGRAGYLDEAWDFIQTMPIKPDASVWGAMLGSCRIHGNIEFAEIAAKELFKLEPYNSA 331 Query: 185 NYLLMMNLYSAENRWEDVENLRDLMGVVGLKSK 283 NY+LM++LY+ NRWEDV+ ++DLM G+K + Sbjct: 332 NYVLMLSLYAMSNRWEDVDRIKDLMDTRGIKPR 364 >ref|XP_003637737.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355503672|gb|AES84875.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 561 Score = 133 bits (335), Expect = 1e-29 Identities = 62/92 (67%), Positives = 78/92 (84%) Frame = +2 Query: 2 VDLLGRGGYLDEAWYFIQTMPLEPDASVWGALLGSCRIHKNLDLAEIAAKYLFKLEPYNS 181 VDLLG+ G+LDEA +FI+TMP++PDAS+WGALL SC+IHKN+ LAEIAA+ LFK+EP NS Sbjct: 333 VDLLGKSGFLDEASHFIETMPIKPDASIWGALLASCKIHKNIKLAEIAARKLFKMEPNNS 392 Query: 182 ANYLLMMNLYSAENRWEDVENLRDLMGVVGLK 277 ANY+LMMNLYS+ NRW VE L+ M V+ +K Sbjct: 393 ANYVLMMNLYSSLNRWVAVERLKHSMTVLAMK 424