BLASTX nr result
ID: Coptis21_contig00035820
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00035820 (325 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CBI20844.3| unnamed protein product [Vitis vinifera] 69 5e-10 ref|XP_003535453.1| PREDICTED: pentatricopeptide repeat-containi... 61 1e-07 ref|XP_003590744.1| Pentatricopeptide repeat-containing protein ... 60 2e-07 gb|AEX12054.1| hypothetical protein 0_18789_01 [Pinus taeda] 59 4e-07 ref|XP_003545972.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-07 >emb|CBI20844.3| unnamed protein product [Vitis vinifera] Length = 700 Score = 68.6 bits (166), Expect = 5e-10 Identities = 30/36 (83%), Positives = 34/36 (94%) Frame = -2 Query: 324 LSNIYASKQLWHEVARIRDLMRDMGVEKEPGSSWVE 217 LSNIYASK+LW EV+RIRDLM+DMGVEKEPG SW+E Sbjct: 658 LSNIYASKELWSEVSRIRDLMKDMGVEKEPGCSWIE 693 >ref|XP_003535453.1| PREDICTED: pentatricopeptide repeat-containing protein At1g25360-like [Glycine max] Length = 782 Score = 60.8 bits (146), Expect = 1e-07 Identities = 27/48 (56%), Positives = 36/48 (75%) Frame = -2 Query: 324 LSNIYASKQLWHEVARIRDLMRDMGVEKEPGSSWVEISDMGYAFGVKD 181 LSN+YA+ W EVAR+R LMR+ GV+KEPG SW+E+ +M + F V D Sbjct: 619 LSNMYAALGQWDEVARVRKLMRERGVKKEPGCSWIEVENMVHVFLVDD 666 >ref|XP_003590744.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355479792|gb|AES60995.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 795 Score = 60.1 bits (144), Expect = 2e-07 Identities = 28/48 (58%), Positives = 36/48 (75%) Frame = -2 Query: 324 LSNIYASKQLWHEVARIRDLMRDMGVEKEPGSSWVEISDMGYAFGVKD 181 LSN+YA+ W EVAR+R LMR+ GV+KEPG SWVE+ +M + F V D Sbjct: 632 LSNMYAALGQWDEVARVRLLMRERGVKKEPGCSWVEVENMVHVFLVDD 679 >gb|AEX12054.1| hypothetical protein 0_18789_01 [Pinus taeda] Length = 161 Score = 58.9 bits (141), Expect = 4e-07 Identities = 25/48 (52%), Positives = 35/48 (72%) Frame = -2 Query: 324 LSNIYASKQLWHEVARIRDLMRDMGVEKEPGSSWVEISDMGYAFGVKD 181 LSNIYA+ W +V R+R +M+D G++K PGSSW+E++ YAF V D Sbjct: 39 LSNIYAACSRWDDVKRVRKIMKDQGIQKMPGSSWIEVNGKVYAFLVGD 86 >ref|XP_003545972.1| PREDICTED: pentatricopeptide repeat-containing protein At3g57430, chloroplastic-like [Glycine max] Length = 858 Score = 58.9 bits (141), Expect = 4e-07 Identities = 28/52 (53%), Positives = 35/52 (67%) Frame = -2 Query: 324 LSNIYASKQLWHEVARIRDLMRDMGVEKEPGSSWVEISDMGYAFGVKD*SLS 169 L+NIYAS +W VA++R M+D V+KEPG SW+EI D Y F V D S S Sbjct: 695 LANIYASAGMWENVAKVRKFMKDSKVKKEPGMSWIEIKDKVYTFIVGDRSHS 746