BLASTX nr result
ID: Coptis21_contig00035819
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00035819 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002316000.1| predicted protein [Populus trichocarpa] gi|2... 74 5e-12 ref|XP_002514579.1| pentatricopeptide repeat-containing protein,... 73 3e-11 ref|XP_002892763.1| predicted protein [Arabidopsis lyrata subsp.... 65 4e-09 gb|AAF99828.1|AC027134_10 Hypothetical protein [Arabidopsis thal... 64 1e-08 gb|AAF81289.1|AC027656_6 Contains similarity to a hypothetical p... 64 1e-08 >ref|XP_002316000.1| predicted protein [Populus trichocarpa] gi|222865040|gb|EEF02171.1| predicted protein [Populus trichocarpa] Length = 745 Score = 74.3 bits (181), Expect(2) = 5e-12 Identities = 35/61 (57%), Positives = 46/61 (75%) Frame = -1 Query: 276 VMLFNQMRDIGFEISIRDYSAVINRLCKRCCIDEVKILLSQMLVDGISPDQKLHEVINQH 97 V +F+QM + GFE+SI+DYSAVINRLCKRC I+E K ML DG+SPDQ++ E++ Sbjct: 661 VKVFHQMVEKGFEVSIKDYSAVINRLCKRCLINEAKYYFCIMLSDGVSPDQEIFEMMLNA 720 Query: 96 F 94 F Sbjct: 721 F 721 Score = 21.2 bits (43), Expect(2) = 5e-12 Identities = 11/25 (44%), Positives = 14/25 (56%) Frame = -2 Query: 101 NTFYHGRDLISVLELLG*MIKTDML 27 N F+ + SV ELL MIK +L Sbjct: 719 NAFHRAGHVHSVFELLAVMIKFGLL 743 >ref|XP_002514579.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] gi|223546183|gb|EEF47685.1| pentatricopeptide repeat-containing protein, putative [Ricinus communis] Length = 840 Score = 72.8 bits (177), Expect = 3e-11 Identities = 35/61 (57%), Positives = 41/61 (67%) Frame = -1 Query: 276 VMLFNQMRDIGFEISIRDYSAVINRLCKRCCIDEVKILLSQMLVDGISPDQKLHEVINQH 97 V+ F QM + GFE+SIRDYSAVI RLCKRC + E K ML DG+ PDQ L EV+ Sbjct: 756 VVYFRQMVEKGFEVSIRDYSAVIGRLCKRCLVTEAKYFFCMMLSDGVCPDQDLFEVLLNA 815 Query: 96 F 94 F Sbjct: 816 F 816 >ref|XP_002892763.1| predicted protein [Arabidopsis lyrata subsp. lyrata] gi|297338605|gb|EFH69022.1| predicted protein [Arabidopsis lyrata subsp. lyrata] Length = 804 Score = 65.5 bits (158), Expect = 4e-09 Identities = 36/67 (53%), Positives = 43/67 (64%), Gaps = 2/67 (2%) Frame = -1 Query: 276 VMLFNQMRDIGFEISIRDYSAVINRLCKRCCIDEVKILLSQMLVDGISPDQKLHEVI--N 103 V+LFNQ+ D GF +SIRDYSAVINRLC+R E K ML GISPD + EV+ + Sbjct: 729 VILFNQLLDRGFNVSIRDYSAVINRLCRRHLAIESKYFFCLMLSRGISPDLDICEVMIKS 788 Query: 102 QHFLPWT 82 L WT Sbjct: 789 DELLSWT 795 >gb|AAF99828.1|AC027134_10 Hypothetical protein [Arabidopsis thaliana] Length = 337 Score = 64.3 bits (155), Expect = 1e-08 Identities = 34/67 (50%), Positives = 43/67 (64%), Gaps = 2/67 (2%) Frame = -1 Query: 276 VMLFNQMRDIGFEISIRDYSAVINRLCKRCCIDEVKILLSQMLVDGISPDQKLHEVI--N 103 V LF+Q+ GF +SIRDYSAVINRLC+R ++E K ML GISPD + EV+ + Sbjct: 263 VKLFHQLLHRGFNVSIRDYSAVINRLCRRHLVNESKFFFCLMLSQGISPDLDICEVMIKS 322 Query: 102 QHFLPWT 82 L WT Sbjct: 323 DELLSWT 329 >gb|AAF81289.1|AC027656_6 Contains similarity to a hypothetical protein F23N19.4 gi|6630464 from Arabidopsis thaliana BAC F23N19 gb|AC007190. It contains a PPR repeat domain PF|01535 [Arabidopsis thaliana] Length = 797 Score = 64.3 bits (155), Expect = 1e-08 Identities = 34/67 (50%), Positives = 43/67 (64%), Gaps = 2/67 (2%) Frame = -1 Query: 276 VMLFNQMRDIGFEISIRDYSAVINRLCKRCCIDEVKILLSQMLVDGISPDQKLHEVI--N 103 V LF+Q+ GF +SIRDYSAVINRLC+R ++E K ML GISPD + EV+ + Sbjct: 723 VKLFHQLLHRGFNVSIRDYSAVINRLCRRHLVNESKFFFCLMLSQGISPDLDICEVMIKS 782 Query: 102 QHFLPWT 82 L WT Sbjct: 783 DELLSWT 789