BLASTX nr result
ID: Coptis21_contig00035697
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00035697 (308 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003595517.1| Pentatricopeptide repeat-containing protein ... 44 2e-07 gb|ABN06148.1| Pentatricopeptide repeat [Medicago truncatula] 44 2e-07 >ref|XP_003595517.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355484565|gb|AES65768.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 1705 Score = 43.5 bits (101), Expect(2) = 2e-07 Identities = 19/40 (47%), Positives = 26/40 (65%) Frame = -1 Query: 122 WLLRAMEMKNIVANVELYSMIVDGLCKQNRVNDGLGVFKE 3 +LLR E +N+ NV Y+ I+D LCK+NRV D +F E Sbjct: 1430 FLLRQAERENVSLNVVTYNPIIDSLCKENRVTDAFDLFNE 1469 Score = 36.2 bits (82), Expect(2) = 2e-07 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -2 Query: 196 VGNGYTVDHVTYGVVINGLCKGMNVG 119 V GY +DH+TYG +IN LCK G Sbjct: 1401 VAQGYQLDHLTYGTLINALCKRRETG 1426 >gb|ABN06148.1| Pentatricopeptide repeat [Medicago truncatula] Length = 116 Score = 43.5 bits (101), Expect(2) = 2e-07 Identities = 19/40 (47%), Positives = 26/40 (65%) Frame = -1 Query: 122 WLLRAMEMKNIVANVELYSMIVDGLCKQNRVNDGLGVFKE 3 +LLR E +N+ NV Y+ I+D LCK+NRV D +F E Sbjct: 50 FLLRQAERENVSLNVVTYNPIIDSLCKENRVTDAFDLFNE 89 Score = 36.2 bits (82), Expect(2) = 2e-07 Identities = 14/26 (53%), Positives = 17/26 (65%) Frame = -2 Query: 196 VGNGYTVDHVTYGVVINGLCKGMNVG 119 V GY +DH+TYG +IN LCK G Sbjct: 21 VAQGYQLDHLTYGTLINALCKRRETG 46