BLASTX nr result
ID: Coptis21_contig00035537
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00035537 (264 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002272955.2| PREDICTED: uncharacterized protein LOC100263... 58 7e-07 emb|CAN66800.1| hypothetical protein VITISV_015402 [Vitis vinifera] 58 7e-07 >ref|XP_002272955.2| PREDICTED: uncharacterized protein LOC100263256 [Vitis vinifera] Length = 703 Score = 58.2 bits (139), Expect = 7e-07 Identities = 32/55 (58%), Positives = 39/55 (70%), Gaps = 4/55 (7%) Frame = -2 Query: 155 DDQLIRPHSLLPKPEAPPGLLKSASNGE--KMDRSVSLNET--NFGKFIRDRSNS 3 D+Q+I PHS LPKPEAPPGLL S + +++RS SL E GK+IRDRSNS Sbjct: 133 DEQIIPPHSQLPKPEAPPGLLNPPSMEDYYRVERSQSLTENLPAIGKYIRDRSNS 187 >emb|CAN66800.1| hypothetical protein VITISV_015402 [Vitis vinifera] Length = 773 Score = 58.2 bits (139), Expect = 7e-07 Identities = 32/55 (58%), Positives = 39/55 (70%), Gaps = 4/55 (7%) Frame = -2 Query: 155 DDQLIRPHSLLPKPEAPPGLLKSASNGE--KMDRSVSLNET--NFGKFIRDRSNS 3 D+Q+I PHS LPKPEAPPGLL S + +++RS SL E GK+IRDRSNS Sbjct: 133 DEQIIPPHSQLPKPEAPPGLLNPPSMEDYYRVERSQSLTENLPAIGKYIRDRSNS 187