BLASTX nr result
ID: Coptis21_contig00035521
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00035521 (284 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002282418.2| PREDICTED: O-acyltransferase WSD1-like [Viti... 59 4e-07 >ref|XP_002282418.2| PREDICTED: O-acyltransferase WSD1-like [Vitis vinifera] Length = 412 Score = 58.9 bits (141), Expect = 4e-07 Identities = 27/38 (71%), Positives = 32/38 (84%) Frame = +2 Query: 170 MSSPKKEVEEDEPVTPAGRMFLQPEMDQVINCAIGLQH 283 M SP E+E DEPVTPAGR+FL+PEMDQVINC IG ++ Sbjct: 1 MGSP--EIERDEPVTPAGRLFLRPEMDQVINCVIGAEN 36