BLASTX nr result
ID: Coptis21_contig00034768
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00034768 (298 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004156559.1| PREDICTED: putative BTB/POZ domain-containin... 86 4e-15 ref|XP_004137290.1| PREDICTED: putative BTB/POZ domain-containin... 86 4e-15 ref|XP_003532824.1| PREDICTED: putative BTB/POZ domain-containin... 82 5e-14 ref|XP_003524263.1| PREDICTED: putative BTB/POZ domain-containin... 81 8e-14 ref|XP_002531260.1| Root phototropism protein, putative [Ricinus... 81 1e-13 >ref|XP_004156559.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3-like [Cucumis sativus] Length = 616 Score = 85.5 bits (210), Expect = 4e-15 Identities = 42/83 (50%), Positives = 59/83 (71%), Gaps = 1/83 (1%) Frame = -3 Query: 248 VLFSEQVKIRAAMKENDPKQHEIVFEQDVSLSTKKQIKTIMCELQKIRTQMAELQHDYSD 69 VLFSEQVK+R+AM+E + LST ++IK + EL+ ++ QMAELQ DYS+ Sbjct: 498 VLFSEQVKMRSAMQEKEKAPSSDSDHDGNHLSTDREIKNLKTELESVKAQMAELQSDYSE 557 Query: 68 LQREFDKL-NKQKSISGWSSGWK 3 LQ+E++K+ NKQK+I+GW GWK Sbjct: 558 LQQEYEKISNKQKNIAGWGFGWK 580 >ref|XP_004137290.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3-like [Cucumis sativus] Length = 616 Score = 85.5 bits (210), Expect = 4e-15 Identities = 42/83 (50%), Positives = 59/83 (71%), Gaps = 1/83 (1%) Frame = -3 Query: 248 VLFSEQVKIRAAMKENDPKQHEIVFEQDVSLSTKKQIKTIMCELQKIRTQMAELQHDYSD 69 VLFSEQVK+R+AM+E + LST ++IK + EL+ ++ QMAELQ DYS+ Sbjct: 498 VLFSEQVKMRSAMQEKEKAPSSDSDHDGNHLSTDREIKNLKTELESVKAQMAELQSDYSE 557 Query: 68 LQREFDKL-NKQKSISGWSSGWK 3 LQ+E++K+ NKQK+I+GW GWK Sbjct: 558 LQQEYEKISNKQKNIAGWGFGWK 580 >ref|XP_003532824.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3-like [Glycine max] Length = 626 Score = 82.0 bits (201), Expect = 5e-14 Identities = 43/84 (51%), Positives = 59/84 (70%), Gaps = 2/84 (2%) Frame = -3 Query: 248 VLFSEQVKIRAAMKENDPKQHEIVFEQDVS-LSTKKQIKTIMCELQKIRTQMAELQHDYS 72 VLFSEQVK+RAAM E +P Q I EQ+ + S IK + EL+ +++QM ELQ+DY Sbjct: 502 VLFSEQVKMRAAMHEKEPAQIGIQSEQEENQTSATMDIKALKAELENVKSQMVELQNDYC 561 Query: 71 DLQREFDKL-NKQKSISGWSSGWK 3 +LQ+E++KL NK K+ SGWS W+ Sbjct: 562 ELQQEYEKLSNKPKNSSGWSLNWR 585 >ref|XP_003524263.1| PREDICTED: putative BTB/POZ domain-containing protein DOT3-like [Glycine max] Length = 629 Score = 81.3 bits (199), Expect = 8e-14 Identities = 42/84 (50%), Positives = 59/84 (70%), Gaps = 2/84 (2%) Frame = -3 Query: 248 VLFSEQVKIRAAMKENDPKQHEIVFEQDVS-LSTKKQIKTIMCELQKIRTQMAELQHDYS 72 +LFSEQVK+RAAM E +P Q I EQ+ + S IK + EL+ +++QM ELQ+DY Sbjct: 505 ILFSEQVKMRAAMHEKEPAQIGIQSEQEGNHTSATMDIKALKAELENVKSQMVELQNDYC 564 Query: 71 DLQREFDKL-NKQKSISGWSSGWK 3 +LQ+E++KL NK K+ SGWS W+ Sbjct: 565 ELQQEYEKLSNKPKNSSGWSLNWR 588 >ref|XP_002531260.1| Root phototropism protein, putative [Ricinus communis] gi|223529145|gb|EEF31124.1| Root phototropism protein, putative [Ricinus communis] Length = 643 Score = 80.9 bits (198), Expect = 1e-13 Identities = 43/84 (51%), Positives = 58/84 (69%), Gaps = 2/84 (2%) Frame = -3 Query: 248 VLFSEQVKIRAAMKENDPKQHEIVFEQDVS-LSTKKQIKTIMCELQKIRTQMAELQHDYS 72 VLFSEQVK+R AM+ +P EQ+VS STK +I T+ EL+ ++ +MAELQ DYS Sbjct: 520 VLFSEQVKMREAMRGKEPAASGNNSEQEVSQTSTKAEIMTLKTELENVKAKMAELQRDYS 579 Query: 71 DLQREFDKLN-KQKSISGWSSGWK 3 +LQ E+ K+N KQ+ + GWS WK Sbjct: 580 ELQHEYVKINSKQRHLPGWSFNWK 603