BLASTX nr result
ID: Coptis21_contig00034469
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00034469 (540 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|YP_002836134.1| hypothetical chloroplast RF2 [Megaleranthis ... 88 9e-16 gb|AER53509.1| hypothetical chloroplast protein [Asclepias albic... 86 4e-15 gb|AER53429.1| hypothetical chloroplast protein [Asclepias subul... 86 4e-15 gb|AER53347.1| hypothetical chloroplast protein [Asclepias subul... 86 4e-15 gb|AER53265.1| hypothetical chloroplast protein [Asclepias subap... 86 4e-15 >ref|YP_002836134.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] gi|229577815|ref|YP_002836151.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] gi|226933926|gb|ACO92059.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] gi|226933943|gb|ACO92076.1| hypothetical chloroplast RF2 [Megaleranthis saniculifolia] Length = 2288 Score = 87.8 bits (216), Expect = 9e-16 Identities = 42/42 (100%), Positives = 42/42 (100%) Frame = +3 Query: 414 QREIQQLKERSILWDPSFLQTERTEIESDRFPKCLSGDSSMS 539 QREIQQLKERSILWDPSFLQTERTEIESDRFPKCLSGDSSMS Sbjct: 425 QREIQQLKERSILWDPSFLQTERTEIESDRFPKCLSGDSSMS 466 >gb|AER53509.1| hypothetical chloroplast protein [Asclepias albicans x Asclepias subulata] gi|355332849|gb|AER53525.1| hypothetical chloroplast protein [Asclepias albicans x Asclepias subulata] Length = 2069 Score = 85.9 bits (211), Expect = 4e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +3 Query: 414 QREIQQLKERSILWDPSFLQTERTEIESDRFPKCLSGDSSMS 539 QREIQQLKERSILWDPSFLQTERTEIESDRFPKCLSG+SSMS Sbjct: 233 QREIQQLKERSILWDPSFLQTERTEIESDRFPKCLSGNSSMS 274 >gb|AER53429.1| hypothetical chloroplast protein [Asclepias subulata] gi|355332768|gb|AER53445.1| hypothetical chloroplast protein [Asclepias subulata] Length = 2054 Score = 85.9 bits (211), Expect = 4e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +3 Query: 414 QREIQQLKERSILWDPSFLQTERTEIESDRFPKCLSGDSSMS 539 QREIQQLKERSILWDPSFLQTERTEIESDRFPKCLSG+SSMS Sbjct: 233 QREIQQLKERSILWDPSFLQTERTEIESDRFPKCLSGNSSMS 274 >gb|AER53347.1| hypothetical chloroplast protein [Asclepias subulata] gi|355332685|gb|AER53363.1| hypothetical chloroplast protein [Asclepias subulata] Length = 2054 Score = 85.9 bits (211), Expect = 4e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +3 Query: 414 QREIQQLKERSILWDPSFLQTERTEIESDRFPKCLSGDSSMS 539 QREIQQLKERSILWDPSFLQTERTEIESDRFPKCLSG+SSMS Sbjct: 233 QREIQQLKERSILWDPSFLQTERTEIESDRFPKCLSGNSSMS 274 >gb|AER53265.1| hypothetical chloroplast protein [Asclepias subaphylla] gi|355332602|gb|AER53281.1| hypothetical chloroplast protein [Asclepias subaphylla] Length = 2055 Score = 85.9 bits (211), Expect = 4e-15 Identities = 41/42 (97%), Positives = 42/42 (100%) Frame = +3 Query: 414 QREIQQLKERSILWDPSFLQTERTEIESDRFPKCLSGDSSMS 539 QREIQQLKERSILWDPSFLQTERTEIESDRFPKCLSG+SSMS Sbjct: 233 QREIQQLKERSILWDPSFLQTERTEIESDRFPKCLSGNSSMS 274