BLASTX nr result
ID: Coptis21_contig00034443
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00034443 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003533559.1| PREDICTED: pentatricopeptide repeat-containi... 58 9e-07 ref|XP_002322376.1| predicted protein [Populus trichocarpa] gi|2... 55 4e-06 >ref|XP_003533559.1| PREDICTED: pentatricopeptide repeat-containing protein At4g19890-like [Glycine max] Length = 693 Score = 57.8 bits (138), Expect = 9e-07 Identities = 30/63 (47%), Positives = 43/63 (68%) Frame = +2 Query: 92 SFISNICNLVQQSYHQQHLHLTSSFKHKPLYLQLNPSLITPEQAVTIFASLFTHAGSMVA 271 S ++ +C+LV SYH + H + F L+L ++P+ +T +QAVTI ASL + AGSMVA Sbjct: 38 STVTRVCSLVYDSYHHHYNH--ARFSPPTLHLDVDPNSLTHDQAVTIVASLASDAGSMVA 95 Query: 272 LSF 280 LSF Sbjct: 96 LSF 98 >ref|XP_002322376.1| predicted protein [Populus trichocarpa] gi|222869372|gb|EEF06503.1| predicted protein [Populus trichocarpa] Length = 715 Score = 55.5 bits (132), Expect = 4e-06 Identities = 30/63 (47%), Positives = 42/63 (66%) Frame = +2 Query: 92 SFISNICNLVQQSYHQQHLHLTSSFKHKPLYLQLNPSLITPEQAVTIFASLFTHAGSMVA 271 S + +IC+LV +SY QQ H+ + + L +NP +T EQA+T+ ASL + AGSMVA Sbjct: 66 SLVRSICSLVCESYSQQTPHVRL-LQSPSINLSVNPDSLTHEQAITVVASLASEAGSMVA 124 Query: 272 LSF 280 LSF Sbjct: 125 LSF 127