BLASTX nr result
ID: Coptis21_contig00034203
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00034203 (347 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520658.1| conserved hypothetical protein [Ricinus comm... 57 1e-06 >ref|XP_002520658.1| conserved hypothetical protein [Ricinus communis] gi|223540043|gb|EEF41620.1| conserved hypothetical protein [Ricinus communis] Length = 250 Score = 57.4 bits (137), Expect = 1e-06 Identities = 34/115 (29%), Positives = 56/115 (48%) Frame = -2 Query: 346 KHVRWNGPWTIQGFIFSVKSAKSLEGGDTERNFDLVDFWVQIYGLPRDKINDANVRSVGS 167 K V GPWT + + K E E DFW+Q+Y LP ++ V+++G+ Sbjct: 95 KRVENGGPWTFNNYHILLHRLKEKENPH-EVELKWTDFWIQVYRLPIGFRSEKVVKNIGN 153 Query: 166 HLGKVKVVDLCCSSEFHKPVARVRVRMDIKERLLKGIELSTEVGEVIPVTFKYEK 2 ++G+ DL + R+RVR+D + LL +++ GE + FKYE+ Sbjct: 154 YVGEYLESDLNNFDGTWREYIRLRVRVDSTKPLLANMKIKKVGGESSAIDFKYER 208