BLASTX nr result
ID: Coptis21_contig00033650
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00033650 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281549.1| PREDICTED: putative pentatricopeptide repeat... 101 6e-20 ref|XP_003523727.1| PREDICTED: putative pentatricopeptide repeat... 97 1e-18 ref|XP_002309575.1| predicted protein [Populus trichocarpa] gi|2... 95 7e-18 gb|EEC78291.1| hypothetical protein OsI_18005 [Oryza sativa Indi... 91 8e-17 emb|CAJ86042.1| H0723C07.12 [Oryza sativa Indica Group] 91 8e-17 >ref|XP_002281549.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130 [Vitis vinifera] gi|296083673|emb|CBI23662.3| unnamed protein product [Vitis vinifera] Length = 685 Score = 101 bits (252), Expect = 6e-20 Identities = 42/49 (85%), Positives = 48/49 (97%) Frame = +3 Query: 3 RIFKNLRVCGDCHEFIKELSKVVKKVFVVRDANRFHRFENGVCTCGDYW 149 R+FKNLRVCGDCHEFIK LSK++KKVFVVRDANRFHRFE+G+C+CGDYW Sbjct: 637 RVFKNLRVCGDCHEFIKGLSKILKKVFVVRDANRFHRFEDGLCSCGDYW 685 >ref|XP_003523727.1| PREDICTED: putative pentatricopeptide repeat-containing protein At3g15130-like [Glycine max] Length = 586 Score = 97.4 bits (241), Expect = 1e-18 Identities = 42/49 (85%), Positives = 45/49 (91%) Frame = +3 Query: 3 RIFKNLRVCGDCHEFIKELSKVVKKVFVVRDANRFHRFENGVCTCGDYW 149 RIFKNLRVCGDCH FIK LSKV+K FVVRDANRFHRFENG+C+CGDYW Sbjct: 538 RIFKNLRVCGDCHAFIKGLSKVLKIAFVVRDANRFHRFENGLCSCGDYW 586 >ref|XP_002309575.1| predicted protein [Populus trichocarpa] gi|222855551|gb|EEE93098.1| predicted protein [Populus trichocarpa] Length = 653 Score = 94.7 bits (234), Expect = 7e-18 Identities = 39/49 (79%), Positives = 46/49 (93%) Frame = +3 Query: 3 RIFKNLRVCGDCHEFIKELSKVVKKVFVVRDANRFHRFENGVCTCGDYW 149 R+FKNLRVCGDCHEFIK LSK+++ VFVVRDANRFHRFE+G+C+C DYW Sbjct: 605 RVFKNLRVCGDCHEFIKGLSKILRVVFVVRDANRFHRFEDGLCSCRDYW 653 >gb|EEC78291.1| hypothetical protein OsI_18005 [Oryza sativa Indica Group] Length = 690 Score = 91.3 bits (225), Expect = 8e-17 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +3 Query: 3 RIFKNLRVCGDCHEFIKELSKVVKKVFVVRDANRFHRFENGVCTCGDYW 149 R++KNLRVCGDCHEF+K LS VV++V VVRDANRFHRF+NG C+C DYW Sbjct: 642 RVYKNLRVCGDCHEFLKGLSAVVRRVVVVRDANRFHRFQNGACSCRDYW 690 >emb|CAJ86042.1| H0723C07.12 [Oryza sativa Indica Group] Length = 886 Score = 91.3 bits (225), Expect = 8e-17 Identities = 37/49 (75%), Positives = 44/49 (89%) Frame = +3 Query: 3 RIFKNLRVCGDCHEFIKELSKVVKKVFVVRDANRFHRFENGVCTCGDYW 149 R++KNLRVCGDCHEF+K LS VV++V VVRDANRFHRF+NG C+C DYW Sbjct: 838 RVYKNLRVCGDCHEFLKGLSAVVRRVVVVRDANRFHRFQNGACSCRDYW 886