BLASTX nr result
ID: Coptis21_contig00033456
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00033456 (403 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABW81018.1| gag-pol polymerase [Arabidopsis lyrata subsp. lyr... 71 1e-10 gb|AAD30632.1|AC006085_5 Hypothetical protein [Arabidopsis thali... 70 1e-10 gb|AAD20433.1| putative retroelement pol polyprotein [Arabidopsi... 65 4e-09 gb|AAD20101.1| putative retroelement pol polyprotein [Arabidopsi... 63 2e-08 gb|AAC62796.1| contains similarity to reverse transcriptase (Pfa... 61 8e-08 >gb|ABW81018.1| gag-pol polymerase [Arabidopsis lyrata subsp. lyrata] Length = 672 Score = 70.9 bits (172), Expect = 1e-10 Identities = 34/60 (56%), Positives = 40/60 (66%), Gaps = 4/60 (6%) Frame = +1 Query: 7 FMVVDSPSQYNAILGRRWIHEMKAVPSTYYQVIRFPTPTGTYEVRGDQVTSKN----SHR 174 F+V D P+ YN ILG WI+ MKAVPSTYYQ I+FPT G +RGDQ S+ SHR Sbjct: 609 FVVFDKPAAYNIILGTPWIYRMKAVPSTYYQCIKFPTSNGVETIRGDQEASRTCYLASHR 668 >gb|AAD30632.1|AC006085_5 Hypothetical protein [Arabidopsis thaliana] Length = 1295 Score = 70.5 bits (171), Expect = 1e-10 Identities = 30/52 (57%), Positives = 39/52 (75%) Frame = +1 Query: 7 FMVVDSPSQYNAILGRRWIHEMKAVPSTYYQVIRFPTPTGTYEVRGDQVTSK 162 F V D P+ YN ILG W++EMKAVPSTY+Q ++FPTPTG ++ G Q TS+ Sbjct: 542 FTVFDRPAAYNIILGTPWLYEMKAVPSTYHQCVKFPTPTGVKQILGSQRTSR 593 >gb|AAD20433.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 889 Score = 65.5 bits (158), Expect = 4e-09 Identities = 30/58 (51%), Positives = 41/58 (70%) Frame = +1 Query: 7 FMVVDSPSQYNAILGRRWIHEMKAVPSTYYQVIRFPTPTGTYEVRGDQVTSKNSHRGT 180 F+VVD + +NAILGR W+H MKAVPSTY+Q I+FP+ G V G Q +S+ + G+ Sbjct: 141 FLVVDKKAPFNAILGRPWLHVMKAVPSTYHQCIKFPSYKGIAVVYGSQRSSRKCYMGS 198 >gb|AAD20101.1| putative retroelement pol polyprotein [Arabidopsis thaliana] Length = 764 Score = 63.2 bits (152), Expect = 2e-08 Identities = 26/49 (53%), Positives = 37/49 (75%) Frame = +1 Query: 4 RFMVVDSPSQYNAILGRRWIHEMKAVPSTYYQVIRFPTPTGTYEVRGDQ 150 +F+VVD P+ YN ILG WIH+M+A+PS+Y+Q I+ PT G +RG+Q Sbjct: 423 KFVVVDKPTIYNIILGTPWIHDMQAIPSSYHQCIKIPTSIGIETIRGNQ 471 >gb|AAC62796.1| contains similarity to reverse transcriptase (Pfam: PF00078 rvt, E=4.3e-08) [Arabidopsis thaliana] gi|7267135|emb|CAB80803.1| AT4g03800 [Arabidopsis thaliana] Length = 637 Score = 61.2 bits (147), Expect = 8e-08 Identities = 28/54 (51%), Positives = 36/54 (66%) Frame = +1 Query: 7 FMVVDSPSQYNAILGRRWIHEMKAVPSTYYQVIRFPTPTGTYEVRGDQVTSKNS 168 F+V D P+ YN ILG WI +MKAVPSTY+Q ++FPT G + GD S+ S Sbjct: 265 FVVFDKPATYNIILGTPWIFQMKAVPSTYHQWLKFPTSNGVETIWGDLEGSRTS 318