BLASTX nr result
ID: Coptis21_contig00033329
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00033329 (312 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527439.1| DNA repair helicase rad5,16, putative [Ricin... 57 1e-06 ref|XP_004161424.1| PREDICTED: putative SWI/SNF-related matrix-a... 55 4e-06 ref|XP_004139464.1| PREDICTED: putative SWI/SNF-related matrix-a... 55 4e-06 ref|XP_003632276.1| PREDICTED: putative SWI/SNF-related matrix-a... 55 4e-06 emb|CBI17093.3| unnamed protein product [Vitis vinifera] 55 4e-06 >ref|XP_002527439.1| DNA repair helicase rad5,16, putative [Ricinus communis] gi|223533174|gb|EEF34931.1| DNA repair helicase rad5,16, putative [Ricinus communis] Length = 1028 Score = 57.4 bits (137), Expect = 1e-06 Identities = 30/49 (61%), Positives = 38/49 (77%), Gaps = 4/49 (8%) Frame = -2 Query: 137 ILADAMGLGKTIMTIALLLSHSERGGSSGI----QASEEATEINSMSEQ 3 ILAD+MGLGKTIMTI+LLL+HSERGG+S Q S E +++N S+Q Sbjct: 414 ILADSMGLGKTIMTISLLLAHSERGGTSSTQFMSQLSTENSDVNDTSDQ 462 >ref|XP_004161424.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Cucumis sativus] Length = 1040 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -2 Query: 137 ILADAMGLGKTIMTIALLLSHSERGGSSGIQASEEATE 24 ILADAMGLGKTIMTI+LLL+HSERGG S Q +TE Sbjct: 430 ILADAMGLGKTIMTISLLLAHSERGGVSNGQLKHSSTE 467 >ref|XP_004139464.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Cucumis sativus] Length = 1040 Score = 55.5 bits (132), Expect = 4e-06 Identities = 28/38 (73%), Positives = 31/38 (81%) Frame = -2 Query: 137 ILADAMGLGKTIMTIALLLSHSERGGSSGIQASEEATE 24 ILADAMGLGKTIMTI+LLL+HSERGG S Q +TE Sbjct: 430 ILADAMGLGKTIMTISLLLAHSERGGVSNGQLKHSSTE 467 >ref|XP_003632276.1| PREDICTED: putative SWI/SNF-related matrix-associated actin-dependent regulator of chromatin subfamily A member 3-like 2-like [Vitis vinifera] Length = 1029 Score = 55.5 bits (132), Expect = 4e-06 Identities = 31/49 (63%), Positives = 38/49 (77%), Gaps = 4/49 (8%) Frame = -2 Query: 137 ILADAMGLGKTIMTIALLLSHSERG----GSSGIQASEEATEINSMSEQ 3 ILADAMGLGKTIMTIALLL+HSE+G S Q E++EI+S+S+Q Sbjct: 415 ILADAMGLGKTIMTIALLLAHSEKGLLASSQSTSQHYHESSEISSISDQ 463 >emb|CBI17093.3| unnamed protein product [Vitis vinifera] Length = 1025 Score = 55.5 bits (132), Expect = 4e-06 Identities = 31/49 (63%), Positives = 38/49 (77%), Gaps = 4/49 (8%) Frame = -2 Query: 137 ILADAMGLGKTIMTIALLLSHSERG----GSSGIQASEEATEINSMSEQ 3 ILADAMGLGKTIMTIALLL+HSE+G S Q E++EI+S+S+Q Sbjct: 411 ILADAMGLGKTIMTIALLLAHSEKGLLASSQSTSQHYHESSEISSISDQ 459