BLASTX nr result
ID: Coptis21_contig00033322
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00033322 (324 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002281921.2| PREDICTED: uncharacterized protein LOC100253... 64 2e-08 emb|CBI20354.3| unnamed protein product [Vitis vinifera] 64 2e-08 ref|XP_002525753.1| conserved hypothetical protein [Ricinus comm... 64 2e-08 ref|XP_004154819.1| PREDICTED: trafficking protein particle comp... 62 6e-08 ref|XP_004150108.1| PREDICTED: trafficking protein particle comp... 62 6e-08 >ref|XP_002281921.2| PREDICTED: uncharacterized protein LOC100253761 [Vitis vinifera] Length = 1259 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +3 Query: 42 KHFGIQRKALPLEPSLLLREANRGRASLSVGNMLEL 149 KHFGIQRK LPLEPS+LLREANR RASLS GNM+E+ Sbjct: 449 KHFGIQRKPLPLEPSILLREANRRRASLSAGNMVEM 484 >emb|CBI20354.3| unnamed protein product [Vitis vinifera] Length = 1258 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +3 Query: 42 KHFGIQRKALPLEPSLLLREANRGRASLSVGNMLEL 149 KHFGIQRK LPLEPS+LLREANR RASLS GNM+E+ Sbjct: 449 KHFGIQRKPLPLEPSILLREANRRRASLSAGNMVEM 484 >ref|XP_002525753.1| conserved hypothetical protein [Ricinus communis] gi|223534903|gb|EEF36589.1| conserved hypothetical protein [Ricinus communis] Length = 1043 Score = 63.5 bits (153), Expect = 2e-08 Identities = 30/36 (83%), Positives = 33/36 (91%) Frame = +3 Query: 42 KHFGIQRKALPLEPSLLLREANRGRASLSVGNMLEL 149 KHFGIQRK+LPLEPS+LLREANR RASLS GNM E+ Sbjct: 429 KHFGIQRKSLPLEPSVLLREANRRRASLSAGNMFEI 464 >ref|XP_004154819.1| PREDICTED: trafficking protein particle complex subunit 10-like [Cucumis sativus] Length = 1249 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 42 KHFGIQRKALPLEPSLLLREANRGRASLSVGNMLEL 149 KHFGIQ+K LPLEPSLLLREANR RASLS GN LE+ Sbjct: 449 KHFGIQKKHLPLEPSLLLREANRRRASLSAGNTLEM 484 >ref|XP_004150108.1| PREDICTED: trafficking protein particle complex subunit 10-like [Cucumis sativus] Length = 1249 Score = 61.6 bits (148), Expect = 6e-08 Identities = 30/36 (83%), Positives = 32/36 (88%) Frame = +3 Query: 42 KHFGIQRKALPLEPSLLLREANRGRASLSVGNMLEL 149 KHFGIQ+K LPLEPSLLLREANR RASLS GN LE+ Sbjct: 449 KHFGIQKKHLPLEPSLLLREANRRRASLSAGNTLEM 484