BLASTX nr result
ID: Coptis21_contig00033261
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00033261 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003593519.1| Allantoinase [Medicago truncatula] gi|355482... 59 3e-07 ref|XP_002519047.1| allantoinase, putative [Ricinus communis] gi... 57 1e-06 ref|XP_003593522.1| Allantoinase [Medicago truncatula] gi|124360... 57 1e-06 gb|AAR29343.1| allantoinase [Robinia pseudoacacia] 57 1e-06 ref|XP_002305806.1| predicted protein [Populus trichocarpa] gi|2... 57 2e-06 >ref|XP_003593519.1| Allantoinase [Medicago truncatula] gi|355482567|gb|AES63770.1| Allantoinase [Medicago truncatula] Length = 652 Score = 59.3 bits (142), Expect = 3e-07 Identities = 26/38 (68%), Positives = 32/38 (84%) Frame = -1 Query: 258 KVLATFVRGNLIYKEGKHAPAACGVPILVK*MQKSTGV 145 KVL TFVRGNL++K+GKHAPAACGVPIL++ Q+ V Sbjct: 607 KVLDTFVRGNLVFKDGKHAPAACGVPILIRLRQEKVAV 644 >ref|XP_002519047.1| allantoinase, putative [Ricinus communis] gi|223541710|gb|EEF43258.1| allantoinase, putative [Ricinus communis] Length = 500 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/30 (83%), Positives = 27/30 (90%) Frame = -1 Query: 258 KVLATFVRGNLIYKEGKHAPAACGVPILVK 169 KVLATFVRGNL+Y+EGKHAP ACG PIL K Sbjct: 471 KVLATFVRGNLVYREGKHAPTACGSPILAK 500 >ref|XP_003593522.1| Allantoinase [Medicago truncatula] gi|124360607|gb|ABN08606.1| Dihydroorotase [Medicago truncatula] gi|355482570|gb|AES63773.1| Allantoinase [Medicago truncatula] Length = 504 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 258 KVLATFVRGNLIYKEGKHAPAACGVPILVK 169 KVL TFVRGNL++K+GKHAPAACGVPIL K Sbjct: 475 KVLDTFVRGNLVFKDGKHAPAACGVPILAK 504 >gb|AAR29343.1| allantoinase [Robinia pseudoacacia] Length = 512 Score = 57.4 bits (137), Expect = 1e-06 Identities = 25/30 (83%), Positives = 28/30 (93%) Frame = -1 Query: 258 KVLATFVRGNLIYKEGKHAPAACGVPILVK 169 KVL TFVRGNL++K+GKHAPAACGVPIL K Sbjct: 483 KVLDTFVRGNLVFKDGKHAPAACGVPILAK 512 >ref|XP_002305806.1| predicted protein [Populus trichocarpa] gi|222848770|gb|EEE86317.1| predicted protein [Populus trichocarpa] Length = 504 Score = 57.0 bits (136), Expect = 2e-06 Identities = 24/28 (85%), Positives = 27/28 (96%) Frame = -1 Query: 258 KVLATFVRGNLIYKEGKHAPAACGVPIL 175 KV++TFVRGNL+YKEGKHAPAACG PIL Sbjct: 475 KVMSTFVRGNLVYKEGKHAPAACGAPIL 502