BLASTX nr result
ID: Coptis21_contig00033236
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00033236 (276 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAN70896.1| hypothetical protein VITISV_012940 [Vitis vinifera] 61 8e-08 emb|CAN65348.1| hypothetical protein VITISV_000638 [Vitis vinifera] 61 1e-07 emb|CAN80718.1| hypothetical protein VITISV_004147 [Vitis vinifera] 60 2e-07 emb|CAN69474.1| hypothetical protein VITISV_014375 [Vitis vinifera] 60 2e-07 emb|CAN62375.1| hypothetical protein VITISV_028920 [Vitis vinifera] 60 2e-07 >emb|CAN70896.1| hypothetical protein VITISV_012940 [Vitis vinifera] Length = 563 Score = 61.2 bits (147), Expect = 8e-08 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = +1 Query: 1 RILTIDNLERRGMSIPNVCVRCGTEEETIMHLFMQCNVAKQVWNDLTA 144 ++LT+D L+RRG +PN C CG EEETI H+ + C VAK +WN + A Sbjct: 421 KVLTLDRLQRRGWHLPNRCFLCGCEEETINHILIHCTVAKGLWNIILA 468 >emb|CAN65348.1| hypothetical protein VITISV_000638 [Vitis vinifera] Length = 485 Score = 60.8 bits (146), Expect = 1e-07 Identities = 25/48 (52%), Positives = 34/48 (70%) Frame = +1 Query: 1 RILTIDNLERRGMSIPNVCVRCGTEEETIMHLFMQCNVAKQVWNDLTA 144 ++LT+D L+RRG +PN C CG EEETI H+ + C VAK +WN + A Sbjct: 361 KVLTLDRLQRRGWHLPNRCFLCGCEEETINHVLIHCTVAKGLWNIILA 408 >emb|CAN80718.1| hypothetical protein VITISV_004147 [Vitis vinifera] Length = 403 Score = 60.1 bits (144), Expect = 2e-07 Identities = 34/85 (40%), Positives = 47/85 (55%) Frame = +1 Query: 1 RILTIDNLERRGMSIPNVCVRCGTEEETIMHLFMQCNVAKQVWNDLTAKIVTFNSSAPTF 180 ++LT+D L+RRG +PN C CG EEETI H+ + C VAK +W D+ + P Sbjct: 261 KVLTLDRLQRRGWHLPNRCFLCGCEEETINHILIHCTVAKGLW-DIILALCGVQWVLPNS 319 Query: 181 LD*KDVLLLWPKPIVTNFGRRRDYV 255 + K+VL W V GR+R V Sbjct: 320 V--KEVLSSWKGSFV---GRKRKKV 339 >emb|CAN69474.1| hypothetical protein VITISV_014375 [Vitis vinifera] Length = 1383 Score = 60.1 bits (144), Expect = 2e-07 Identities = 24/48 (50%), Positives = 34/48 (70%) Frame = +1 Query: 1 RILTIDNLERRGMSIPNVCVRCGTEEETIMHLFMQCNVAKQVWNDLTA 144 ++LT+D L+RRG +PN C CG EEETI H+ + C +AK +WN + A Sbjct: 898 KVLTLDRLQRRGWHLPNRCFLCGCEEETINHILIHCTMAKGLWNIILA 945 >emb|CAN62375.1| hypothetical protein VITISV_028920 [Vitis vinifera] Length = 843 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/82 (39%), Positives = 48/82 (58%) Frame = +1 Query: 1 RILTIDNLERRGMSIPNVCVRCGTEEETIMHLFMQCNVAKQVWNDLTAKIVTFNSSAPTF 180 ++LT+D L+RRG +PN C CG+EEE++ HL + C V + +W DL + + P Sbjct: 440 KVLTLDRLQRRGWQLPNCCFLCGSEEESVDHLLIHCIVVRVLW-DLVLALFGVHWVFPET 498 Query: 181 LD*KDVLLLWPKPIVTNFGRRR 246 + K VLL W P V G++R Sbjct: 499 V--KKVLLSWRGPFV---GKKR 515