BLASTX nr result
ID: Coptis21_contig00033172
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00033172 (501 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002455392.1| hypothetical protein SORBIDRAFT_03g010050 [S... 61 8e-08 gb|AEP33757.1| organelle transcript processing 82, partial [Aeth... 60 2e-07 ref|XP_003565613.1| PREDICTED: pentatricopeptide repeat-containi... 59 3e-07 ref|XP_003634994.1| PREDICTED: pentatricopeptide repeat-containi... 59 4e-07 ref|XP_002864446.1| pentatricopeptide repeat-containing protein ... 59 4e-07 >ref|XP_002455392.1| hypothetical protein SORBIDRAFT_03g010050 [Sorghum bicolor] gi|241927367|gb|EES00512.1| hypothetical protein SORBIDRAFT_03g010050 [Sorghum bicolor] Length = 506 Score = 61.2 bits (147), Expect = 8e-08 Identities = 27/49 (55%), Positives = 36/49 (73%) Frame = +3 Query: 15 KLEPDNPGNLVLLSNMLAQGKRWDDASMVRDTMKQCGLKKVPGQSSLNV 161 +LEP N GN +LLSN+ A+ +RWDD S +R MK+ GL+ VPG SS+ V Sbjct: 408 ELEPSNSGNYILLSNIFAEQERWDDVSKLRKAMKERGLRNVPGASSIEV 456 >gb|AEP33757.1| organelle transcript processing 82, partial [Aethionema cordifolium] Length = 679 Score = 59.7 bits (143), Expect = 2e-07 Identities = 27/51 (52%), Positives = 35/51 (68%) Frame = +3 Query: 15 KLEPDNPGNLVLLSNMLAQGKRWDDASMVRDTMKQCGLKKVPGQSSLNVSN 167 K+EP NPG+ VLLSN+ A RWDD + VR + GLKKVPG SS+ + + Sbjct: 510 KIEPKNPGSYVLLSNIYATSARWDDVARVRTLLNDKGLKKVPGCSSIEIDS 560 >ref|XP_003565613.1| PREDICTED: pentatricopeptide repeat-containing protein At5g56310-like [Brachypodium distachyon] Length = 500 Score = 59.3 bits (142), Expect = 3e-07 Identities = 27/49 (55%), Positives = 35/49 (71%) Frame = +3 Query: 15 KLEPDNPGNLVLLSNMLAQGKRWDDASMVRDTMKQCGLKKVPGQSSLNV 161 +LEP N GN +LLSN+ A+ +RWDD S +R MK GL+ VPG SS+ V Sbjct: 399 ELEPHNSGNYILLSNIYAEQERWDDVSKLRKQMKDRGLRNVPGASSIEV 447 >ref|XP_003634994.1| PREDICTED: pentatricopeptide repeat-containing protein At3g63370-like [Vitis vinifera] Length = 993 Score = 58.9 bits (141), Expect = 4e-07 Identities = 36/90 (40%), Positives = 46/90 (51%) Frame = +3 Query: 15 KLEPDNPGNLVLLSNMLAQGKRWDDASMVRDTMKQCGLKKVPGQSSLNVSN*FTNFQLMP 194 +++P+NPGN VL+SN+ A +RW D VR MK GLKK PG S + V N F Sbjct: 817 EMDPENPGNYVLVSNVYAAERRWKDVEEVRMRMKASGLKKNPGCSWIEVGNKVHTFMA-- 874 Query: 195 PWNNYSSVSQNPSLPPYEKLSCCLQRLPKE 284 S S Y KLS ++L KE Sbjct: 875 -----RDKSHPQSYEIYSKLSQITEKLAKE 899 >ref|XP_002864446.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] gi|297310281|gb|EFH40705.1| pentatricopeptide repeat-containing protein [Arabidopsis lyrata subsp. lyrata] Length = 531 Score = 58.9 bits (141), Expect = 4e-07 Identities = 33/87 (37%), Positives = 49/87 (56%) Frame = +3 Query: 15 KLEPDNPGNLVLLSNMLAQGKRWDDASMVRDTMKQCGLKKVPGQSSLNVSN*FTNFQLMP 194 KLEP+N GN +LL+N+ + RWD++ M+R MK G+KK+ G+SS+ V N Sbjct: 447 KLEPNNSGNYMLLANLYSNLGRWDESRMMRKMMKGIGVKKLAGESSIEVEN--------- 497 Query: 195 PWNNYSSVSQNPSLPPYEKLSCCLQRL 275 Y +S + S P EK+ LQ + Sbjct: 498 --RVYKFISGDLSHPQVEKIHELLQEM 522