BLASTX nr result
ID: Coptis21_contig00032345
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00032345 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535169.1| conserved hypothetical protein [Ricinus comm... 86 3e-15 ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] ... 79 3e-13 >ref|XP_002535169.1| conserved hypothetical protein [Ricinus communis] gi|223523841|gb|EEF27214.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 85.9 bits (211), Expect = 3e-15 Identities = 38/41 (92%), Positives = 41/41 (100%) Frame = -3 Query: 179 FIHRAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSHRSARF 57 F++RAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTS+RSARF Sbjct: 39 FLYRAWTMSPEQSQYIWRKTIPHIEVGMGSGVFTSYRSARF 79 >ref|XP_003588337.1| Ribosomal protein S10 [Medicago truncatula] gi|355477385|gb|AES58588.1| Ribosomal protein S10 [Medicago truncatula] Length = 1152 Score = 79.3 bits (194), Expect = 3e-13 Identities = 36/44 (81%), Positives = 39/44 (88%) Frame = +3 Query: 30 SSPAIPTKKKPGTTVRRENTRSHSDLDMWNRLAPYVLRLFGRHG 161 S +I + KPGTTVRRENTRSHSDLDMWNRLAPYVL+LFGRHG Sbjct: 560 SCSSIGNQDKPGTTVRRENTRSHSDLDMWNRLAPYVLKLFGRHG 603