BLASTX nr result
ID: Coptis21_contig00032270
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00032270 (254 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003615476.1| Integral membrane protein-like protein [Medi... 63 2e-08 ref|XP_003544267.1| PREDICTED: uncharacterized protein LOC100800... 55 5e-06 >ref|XP_003615476.1| Integral membrane protein-like protein [Medicago truncatula] gi|355516811|gb|AES98434.1| Integral membrane protein-like protein [Medicago truncatula] Length = 989 Score = 63.2 bits (152), Expect = 2e-08 Identities = 29/68 (42%), Positives = 40/68 (58%), Gaps = 1/68 (1%) Frame = +3 Query: 3 YCDTHDGTWKCHHCTWTYR-MPTSAIHPIQNPNAHSHLPVNVKTLVQNGPSFSLEIKGTE 179 + D G WKCHHCTW+ + + P+ N + LP+NVKTL+Q+GP F E KG Sbjct: 130 FFDKQQGVWKCHHCTWSTKPFDSPRTGPMWNLKGYPDLPMNVKTLIQHGPCFVWETKG-- 187 Query: 180 TCNEIRGI 203 NE+ G+ Sbjct: 188 --NEVNGL 193 >ref|XP_003544267.1| PREDICTED: uncharacterized protein LOC100800852 [Glycine max] Length = 647 Score = 55.5 bits (132), Expect = 5e-06 Identities = 31/81 (38%), Positives = 41/81 (50%) Frame = +3 Query: 3 YCDTHDGTWKCHHCTWTYRMPTSAIHPIQNPNAHSHLPVNVKTLVQNGPSFSLEIKGTET 182 Y D G WKCHHCTWT R + P N + L + VKT++Q+GP F + K Sbjct: 138 YFDEQQGMWKCHHCTWTKRFDSPWTVPNWNLKGYPDL-MTVKTMIQHGPFFVCDTKD--- 193 Query: 183 CNEIRGILYSVAGHSVAEKNL 245 +E+ G+ A SV NL Sbjct: 194 -DEVNGVQNGDAFWSVHPTNL 213