BLASTX nr result
ID: Coptis21_contig00032249
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00032249 (425 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003605185.1| hypothetical protein MTR_4g026350 [Medicago ... 56 3e-06 >ref|XP_003605185.1| hypothetical protein MTR_4g026350 [Medicago truncatula] gi|355506240|gb|AES87382.1| hypothetical protein MTR_4g026350 [Medicago truncatula] Length = 139 Score = 55.8 bits (133), Expect = 3e-06 Identities = 28/65 (43%), Positives = 38/65 (58%), Gaps = 3/65 (4%) Frame = +1 Query: 76 KVKRVRASKQMLINDNGKLIKNDTEELKGSTKSGRVNHKRRS---RHPGFNLDYAPPLTH 246 K K R++ Q ++ D K+ + S S RV H ++ +HPGFNLDY+PP TH Sbjct: 75 KSKHQRSTNQKVLKDMRKVSAELQTKSHVSVSSLRVPHNKKKHSEKHPGFNLDYSPPKTH 134 Query: 247 PPSHN 261 PPSHN Sbjct: 135 PPSHN 139