BLASTX nr result
ID: Coptis21_contig00032062
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00032062 (517 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002279149.2| PREDICTED: pentatricopeptide repeat-containi... 75 4e-12 emb|CBI19926.3| unnamed protein product [Vitis vinifera] 75 4e-12 emb|CAN68525.1| hypothetical protein VITISV_018083 [Vitis vinifera] 73 2e-11 ref|XP_003522561.1| PREDICTED: pentatricopeptide repeat-containi... 69 5e-10 ref|XP_003580963.1| PREDICTED: pentatricopeptide repeat-containi... 56 3e-06 >ref|XP_002279149.2| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial-like [Vitis vinifera] Length = 665 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/65 (52%), Positives = 47/65 (72%) Frame = -2 Query: 516 VARIRKAMQDRGIRKVTDHSWIGIKNRVFAFKGNPVLYCGSEGLYSILSLLVWEMVDKGY 337 + R+R+AM+++G+RKV SWIGIKN VF FK N +L+ G + +Y IL LL+ E+ D GY Sbjct: 591 LVRVRRAMKEKGVRKVIGCSWIGIKNHVFVFKENQLLHIGGKDIYFILRLLIQEIEDDGY 650 Query: 336 ISQSY 322 SQ Y Sbjct: 651 ASQQY 655 >emb|CBI19926.3| unnamed protein product [Vitis vinifera] Length = 486 Score = 75.5 bits (184), Expect = 4e-12 Identities = 34/65 (52%), Positives = 47/65 (72%) Frame = -2 Query: 516 VARIRKAMQDRGIRKVTDHSWIGIKNRVFAFKGNPVLYCGSEGLYSILSLLVWEMVDKGY 337 + R+R+AM+++G+RKV SWIGIKN VF FK N +L+ G + +Y IL LL+ E+ D GY Sbjct: 338 LVRVRRAMKEKGVRKVIGCSWIGIKNHVFVFKENQLLHIGGKDIYFILRLLIQEIEDDGY 397 Query: 336 ISQSY 322 SQ Y Sbjct: 398 ASQQY 402 >emb|CAN68525.1| hypothetical protein VITISV_018083 [Vitis vinifera] Length = 1796 Score = 73.2 bits (178), Expect = 2e-11 Identities = 33/65 (50%), Positives = 46/65 (70%) Frame = -2 Query: 516 VARIRKAMQDRGIRKVTDHSWIGIKNRVFAFKGNPVLYCGSEGLYSILSLLVWEMVDKGY 337 + R+ +AM+++G+RKV SWIGIKN VF FK N +L+ G + +Y IL LL+ E+ D GY Sbjct: 1264 LVRVXRAMKEKGVRKVIGCSWIGIKNHVFVFKENQLLHIGGKDIYFILRLLIQEIEDDGY 1323 Query: 336 ISQSY 322 SQ Y Sbjct: 1324 ASQQY 1328 >ref|XP_003522561.1| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial-like [Glycine max] Length = 630 Score = 68.6 bits (166), Expect = 5e-10 Identities = 29/61 (47%), Positives = 43/61 (70%) Frame = -2 Query: 516 VARIRKAMQDRGIRKVTDHSWIGIKNRVFAFKGNPVLYCGSEGLYSILSLLVWEMVDKGY 337 + R+RKA ++RG ++ HSWIGIKN V+ F N + + G + LY +L+LLVWEM +GY Sbjct: 570 MVRMRKAAENRGSKEFIGHSWIGIKNNVYTFASNQLQHYGGKDLYLVLNLLVWEMETEGY 629 Query: 336 I 334 + Sbjct: 630 V 630 >ref|XP_003580963.1| PREDICTED: pentatricopeptide repeat-containing protein At1g43980, mitochondrial-like [Brachypodium distachyon] Length = 683 Score = 55.8 bits (133), Expect = 3e-06 Identities = 24/57 (42%), Positives = 37/57 (64%) Frame = -2 Query: 516 VARIRKAMQDRGIRKVTDHSWIGIKNRVFAFKGNPVLYCGSEGLYSILSLLVWEMVD 346 VAR+ + M+D+G +KV SW+ IK+ + F V++ G E Y++L LL WEM+D Sbjct: 602 VARMWRLMEDQGAKKVQGCSWLCIKSEIHVFTSEQVVHLGGEATYAVLDLLFWEMMD 658