BLASTX nr result
ID: Coptis21_contig00031644
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00031644 (265 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|ABU55662.1| CBF1-like protein [Ampelopsis glandulosa var. bre... 67 2e-09 ref|XP_003539179.1| PREDICTED: dehydration-responsive element-bi... 66 3e-09 ref|XP_003539462.1| PREDICTED: dehydration-responsive element-bi... 65 4e-09 gb|AAR28672.1| CBF-like transcription factor [Vitis riparia] 65 6e-09 gb|AAR28673.1| CBF-like transcription factor [Vitis vinifera] 65 6e-09 >gb|ABU55662.1| CBF1-like protein [Ampelopsis glandulosa var. brevipedunculata] Length = 206 Score = 66.6 bits (161), Expect = 2e-09 Identities = 28/31 (90%), Positives = 31/31 (100%) Frame = -2 Query: 93 SHKRRAGRKKFKETRHPIYRGVRQRNGSKWV 1 SHKR+AGRKKF+ETRHPIYRGVRQRNG+KWV Sbjct: 16 SHKRKAGRKKFRETRHPIYRGVRQRNGNKWV 46 >ref|XP_003539179.1| PREDICTED: dehydration-responsive element-binding protein 1F-like [Glycine max] Length = 236 Score = 66.2 bits (160), Expect = 3e-09 Identities = 27/31 (87%), Positives = 31/31 (100%) Frame = -2 Query: 93 SHKRRAGRKKFKETRHPIYRGVRQRNGSKWV 1 SHKR+AGRKKF+ETRHP+YRGVRQRNG+KWV Sbjct: 47 SHKRKAGRKKFRETRHPVYRGVRQRNGNKWV 77 >ref|XP_003539462.1| PREDICTED: dehydration-responsive element-binding protein 1F-like [Glycine max] Length = 252 Score = 65.5 bits (158), Expect = 4e-09 Identities = 27/41 (65%), Positives = 35/41 (85%) Frame = -2 Query: 123 SQTIHVPAIQSHKRRAGRKKFKETRHPIYRGVRQRNGSKWV 1 ++T + SHKR+AGRKKF+ETRHP+YRGVRQRNG++WV Sbjct: 50 AETWKAGVLISHKRKAGRKKFRETRHPVYRGVRQRNGNRWV 90 >gb|AAR28672.1| CBF-like transcription factor [Vitis riparia] Length = 251 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 90 HKRRAGRKKFKETRHPIYRGVRQRNGSKWV 1 HKR+AGRKKF+ETRHPIYRGVRQRNG+KWV Sbjct: 35 HKRKAGRKKFRETRHPIYRGVRQRNGNKWV 64 >gb|AAR28673.1| CBF-like transcription factor [Vitis vinifera] Length = 251 Score = 65.1 bits (157), Expect = 6e-09 Identities = 27/30 (90%), Positives = 30/30 (100%) Frame = -2 Query: 90 HKRRAGRKKFKETRHPIYRGVRQRNGSKWV 1 HKR+AGRKKF+ETRHPIYRGVRQRNG+KWV Sbjct: 35 HKRKAGRKKFRETRHPIYRGVRQRNGNKWV 64