BLASTX nr result
ID: Coptis21_contig00031495
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00031495 (499 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002510562.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002510562.1| conserved hypothetical protein [Ricinus communis] gi|223551263|gb|EEF52749.1| conserved hypothetical protein [Ricinus communis] Length = 263 Score = 55.5 bits (132), Expect = 5e-06 Identities = 30/81 (37%), Positives = 40/81 (49%), Gaps = 3/81 (3%) Frame = -3 Query: 389 DIPCMRWAPFIWGRILSLFTQTEAVD---LPYDIIIDIFSRLPAQLIFQCCHSCHMIRTL 219 + C W IW +LS+F + D LP DII +I SRLPA + +CC + L Sbjct: 2 EFECFIWIVHIWKELLSIFPPLKGGDVRPLPNDIIFEILSRLPADEVLKCCSVSKEWKAL 61 Query: 218 TSSPTFVSIHLKRATSVVVIQ 156 +P F L RA +V IQ Sbjct: 62 VLTPFFSQAQLTRACPIVFIQ 82