BLASTX nr result
ID: Coptis21_contig00031451
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00031451 (531 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002464795.1| hypothetical protein SORBIDRAFT_01g026845 [S... 56 4e-06 gb|AAS55787.1| hypothetical protein [Oryza sativa Japonica Group... 55 5e-06 ref|XP_002450418.1| hypothetical protein SORBIDRAFT_05g005061 [S... 55 6e-06 >ref|XP_002464795.1| hypothetical protein SORBIDRAFT_01g026845 [Sorghum bicolor] gi|241918649|gb|EER91793.1| hypothetical protein SORBIDRAFT_01g026845 [Sorghum bicolor] Length = 295 Score = 55.8 bits (133), Expect = 4e-06 Identities = 30/76 (39%), Positives = 39/76 (51%) Frame = -1 Query: 231 MSILCWNCRDIGLDSTVMCLKDDIRNERPGIIFLCETKAGWFKSNNIIRKLGVYKSFIGP 52 M IL WNCR + V L + R E P ++FL ET K N+ RK+G K I Sbjct: 1 MKILAWNCRGLASHRAVRALLEVQRRENPDVLFLSETHLSKAKVENLKRKVGCEKFAIHE 60 Query: 51 ARGLSRGLWLLWDIEI 4 + G S GL +LW E+ Sbjct: 61 SDGRSGGLLMLWKKEV 76 >gb|AAS55787.1| hypothetical protein [Oryza sativa Japonica Group] gi|54291856|gb|AAV32224.1| hypothetical protein [Oryza sativa Japonica Group] Length = 1936 Score = 55.5 bits (132), Expect = 5e-06 Identities = 31/75 (41%), Positives = 44/75 (58%), Gaps = 1/75 (1%) Frame = -1 Query: 234 AMSILCWNCRDIGLDSTVMCLKDDIRNERPGIIFLCETKAGWFKSNNIIRKLGVYKSFIG 55 AMS L WNCR +G +TV L+ I+ ++FLCET+ K + + RKL ++ F+G Sbjct: 635 AMSCLAWNCRGLGNTATVQDLRALIQKAGSQLVFLCETRQSVEKMSRLRRKL-AFRGFVG 693 Query: 54 -PARGLSRGLWLLWD 13 + G S GL L WD Sbjct: 694 VSSEGKSGGLALYWD 708 >ref|XP_002450418.1| hypothetical protein SORBIDRAFT_05g005061 [Sorghum bicolor] gi|241936261|gb|EES09406.1| hypothetical protein SORBIDRAFT_05g005061 [Sorghum bicolor] Length = 753 Score = 55.1 bits (131), Expect = 6e-06 Identities = 27/76 (35%), Positives = 42/76 (55%) Frame = -1 Query: 231 MSILCWNCRDIGLDSTVMCLKDDIRNERPGIIFLCETKAGWFKSNNIIRKLGVYKSFIGP 52 M LCWNCR IG +TV L+D ++ P ++F+ ET+ ++ N+ L SF Sbjct: 1 MKTLCWNCRGIGNPATVKELRDLAKDYAPSVMFIMETQISKYRVENLRYTLSFDNSFAVN 60 Query: 51 ARGLSRGLWLLWDIEI 4 + G S GL L W+ ++ Sbjct: 61 SSGRSGGLGLFWNNDV 76