BLASTX nr result
ID: Coptis21_contig00031407
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00031407 (394 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002520761.1| conserved hypothetical protein [Ricinus comm... 65 4e-09 emb|CBI32367.3| unnamed protein product [Vitis vinifera] 62 6e-08 ref|XP_002272356.1| PREDICTED: uncharacterized protein LOC100249... 62 6e-08 emb|CAN62851.1| hypothetical protein VITISV_010155 [Vitis vinifera] 62 6e-08 ref|XP_002517183.1| conserved hypothetical protein [Ricinus comm... 60 2e-07 >ref|XP_002520761.1| conserved hypothetical protein [Ricinus communis] gi|223540146|gb|EEF41723.1| conserved hypothetical protein [Ricinus communis] Length = 466 Score = 65.5 bits (158), Expect = 4e-09 Identities = 28/36 (77%), Positives = 32/36 (88%) Frame = -3 Query: 392 HWCLPGVPDAWNELLYALFLKREAARSQDSMTSSQA 285 HWCLPGVPD+WNELLYAL LK+EAA +Q+S SSQA Sbjct: 429 HWCLPGVPDSWNELLYALLLKKEAAHAQNSTESSQA 464 >emb|CBI32367.3| unnamed protein product [Vitis vinifera] Length = 419 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -3 Query: 392 HWCLPGVPDAWNELLYALFLKREAARSQDSMTSSQ 288 HWCLPGVPD+WNELLYALFLKRE+ R+++S TS+Q Sbjct: 376 HWCLPGVPDSWNELLYALFLKRESIRTRNS-TSTQ 409 >ref|XP_002272356.1| PREDICTED: uncharacterized protein LOC100249456 [Vitis vinifera] Length = 460 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -3 Query: 392 HWCLPGVPDAWNELLYALFLKREAARSQDSMTSSQ 288 HWCLPGVPD+WNELLYALFLKRE+ R+++S TS+Q Sbjct: 417 HWCLPGVPDSWNELLYALFLKRESIRTRNS-TSTQ 450 >emb|CAN62851.1| hypothetical protein VITISV_010155 [Vitis vinifera] Length = 463 Score = 61.6 bits (148), Expect = 6e-08 Identities = 27/35 (77%), Positives = 33/35 (94%) Frame = -3 Query: 392 HWCLPGVPDAWNELLYALFLKREAARSQDSMTSSQ 288 HWCLPGVPD+WNELLYALFLKRE+ R+++S TS+Q Sbjct: 420 HWCLPGVPDSWNELLYALFLKRESIRTRNS-TSTQ 453 >ref|XP_002517183.1| conserved hypothetical protein [Ricinus communis] gi|223543818|gb|EEF45346.1| conserved hypothetical protein [Ricinus communis] Length = 453 Score = 59.7 bits (143), Expect = 2e-07 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = -3 Query: 392 HWCLPGVPDAWNELLYALFLKREAARS 312 HWCLPGVPD WNELLYALFLKREAA++ Sbjct: 417 HWCLPGVPDTWNELLYALFLKREAAKT 443