BLASTX nr result
ID: Coptis21_contig00031340
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00031340 (394 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002314047.1| predicted protein [Populus trichocarpa] gi|2... 56 3e-06 ref|XP_002532074.1| conserved hypothetical protein [Ricinus comm... 55 6e-06 >ref|XP_002314047.1| predicted protein [Populus trichocarpa] gi|222850455|gb|EEE88002.1| predicted protein [Populus trichocarpa] Length = 77 Score = 56.2 bits (134), Expect = 3e-06 Identities = 21/27 (77%), Positives = 26/27 (96%) Frame = -3 Query: 263 RYVDLFRIAARIHSHCPQTARMYYHPP 183 +Y+++FRIAAR HSHCPQTAR+YYHPP Sbjct: 4 KYMEMFRIAARFHSHCPQTARVYYHPP 30 >ref|XP_002532074.1| conserved hypothetical protein [Ricinus communis] gi|223528256|gb|EEF30308.1| conserved hypothetical protein [Ricinus communis] Length = 84 Score = 55.1 bits (131), Expect = 6e-06 Identities = 35/83 (42%), Positives = 38/83 (45%), Gaps = 7/83 (8%) Frame = -3 Query: 269 MSRYV---DLFRIAARIHSHCPQTARMYYHPP----SXXXXXXXXXXXXXXXXXXXXNQL 111 M RYV D RIA R +SHCPQTAR+YYHPP S Sbjct: 1 MVRYVEFLDALRIAGRFYSHCPQTARIYYHPPLPSSSSDDHHHHHEHALSVSSMTDAPVQ 60 Query: 110 VSGSCGNKAMDGVETKDLFLYLV 42 S SCG KA G +T DL Y V Sbjct: 61 GSTSCGAKAAKGFDTTDLIFYSV 83