BLASTX nr result
ID: Coptis21_contig00031195
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00031195 (419 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002535305.1| conserved hypothetical protein [Ricinus comm... 117 1e-24 ref|XP_002539361.1| conserved hypothetical protein [Ricinus comm... 53 2e-11 gb|EEC75928.1| hypothetical protein OsI_13019 [Oryza sativa Indi... 64 1e-08 ref|XP_003588296.1| hypothetical protein MTR_1g005540 [Medicago ... 55 6e-06 >ref|XP_002535305.1| conserved hypothetical protein [Ricinus communis] gi|223523491|gb|EEF27078.1| conserved hypothetical protein [Ricinus communis] Length = 183 Score = 117 bits (293), Expect = 1e-24 Identities = 58/63 (92%), Positives = 58/63 (92%) Frame = +2 Query: 131 QAVDSFIREGKKGPKHGRCRTLECQRKARPYLFFQACSDIRFPRKIKLVSRVMGNLLARF 310 QAVDSFIREGKKGPKH RCRTLE QRKA YLFFQACSDIRFPRKIKLVSRVMGNL ARF Sbjct: 121 QAVDSFIREGKKGPKHLRCRTLEWQRKAGSYLFFQACSDIRFPRKIKLVSRVMGNLPARF 180 Query: 311 GEH 319 GEH Sbjct: 181 GEH 183 >ref|XP_002539361.1| conserved hypothetical protein [Ricinus communis] gi|223506854|gb|EEF23023.1| conserved hypothetical protein [Ricinus communis] Length = 62 Score = 52.8 bits (125), Expect(2) = 2e-11 Identities = 26/41 (63%), Positives = 31/41 (75%) Frame = +1 Query: 184 MPYT*VPKESETVPVFPGLFGHTVPAEDQVGEPCDGKPSRT 306 MPYT +++ + +F GHTVPAEDQVGEPCDGKPSRT Sbjct: 1 MPYTEWQRKAGSY-LFSRPVGHTVPAEDQVGEPCDGKPSRT 40 Score = 40.8 bits (94), Expect(2) = 2e-11 Identities = 18/19 (94%), Positives = 19/19 (100%) Frame = +3 Query: 363 GSSLNSQIGPTRNSLLTPC 419 GSSL+SQIGPTRNSLLTPC Sbjct: 41 GSSLDSQIGPTRNSLLTPC 59 >gb|EEC75928.1| hypothetical protein OsI_13019 [Oryza sativa Indica Group] Length = 313 Score = 63.9 bits (154), Expect = 1e-08 Identities = 31/34 (91%), Positives = 31/34 (91%) Frame = -2 Query: 103 R*FTTEANKRLDQEKGVLRALCPTHLTSSRGSPV 2 R TTEA KRLDQEKGVLRALCPTHLTSSRGSPV Sbjct: 263 RFLTTEAKKRLDQEKGVLRALCPTHLTSSRGSPV 296 >ref|XP_003588296.1| hypothetical protein MTR_1g005540 [Medicago truncatula] gi|355477344|gb|AES58547.1| hypothetical protein MTR_1g005540 [Medicago truncatula] Length = 90 Score = 55.1 bits (131), Expect = 6e-06 Identities = 24/25 (96%), Positives = 24/25 (96%) Frame = -3 Query: 102 GDSLPKRIKGWIKKRGYYEPSAPRI 28 GDSLPKR KGWIKKRGYYEPSAPRI Sbjct: 9 GDSLPKRRKGWIKKRGYYEPSAPRI 33