BLASTX nr result
ID: Coptis21_contig00031120
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00031120 (332 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004161840.1| PREDICTED: beta-glucosidase 44-like [Cucumis... 123 2e-26 ref|XP_004137494.1| PREDICTED: beta-glucosidase 44-like [Cucumis... 123 2e-26 ref|XP_003528968.1| PREDICTED: beta-glucosidase 44-like [Glycine... 122 3e-26 ref|XP_002533126.1| beta-glucosidase, putative [Ricinus communis... 122 4e-26 ref|XP_003534146.1| PREDICTED: beta-glucosidase 44-like [Glycine... 120 9e-26 >ref|XP_004161840.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus] Length = 503 Score = 123 bits (308), Expect = 2e-26 Identities = 55/63 (87%), Positives = 59/63 (93%) Frame = +3 Query: 3 QLKKAIDDGANVIGYFAWSLLDNFEWKSGYTSRFGIVYVDYKDLKRYPKMSAYWFKTMLA 182 QLKKA+DDGANVIGYFAWSLLDNFEW+ GYTSRFGIVYVDY +LKRYPKMSAYWFK +L Sbjct: 440 QLKKAVDDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYSNLKRYPKMSAYWFKQLLE 499 Query: 183 RKK 191 RKK Sbjct: 500 RKK 502 >ref|XP_004137494.1| PREDICTED: beta-glucosidase 44-like [Cucumis sativus] Length = 503 Score = 123 bits (308), Expect = 2e-26 Identities = 55/63 (87%), Positives = 59/63 (93%) Frame = +3 Query: 3 QLKKAIDDGANVIGYFAWSLLDNFEWKSGYTSRFGIVYVDYKDLKRYPKMSAYWFKTMLA 182 QLKKA+DDGANVIGYFAWSLLDNFEW+ GYTSRFGIVYVDY +LKRYPKMSAYWFK +L Sbjct: 440 QLKKAVDDGANVIGYFAWSLLDNFEWRLGYTSRFGIVYVDYSNLKRYPKMSAYWFKQLLE 499 Query: 183 RKK 191 RKK Sbjct: 500 RKK 502 >ref|XP_003528968.1| PREDICTED: beta-glucosidase 44-like [Glycine max] Length = 515 Score = 122 bits (306), Expect = 3e-26 Identities = 53/63 (84%), Positives = 60/63 (95%) Frame = +3 Query: 3 QLKKAIDDGANVIGYFAWSLLDNFEWKSGYTSRFGIVYVDYKDLKRYPKMSAYWFKTMLA 182 QLKKA+DDGANV+GYFAWSLLDNFEW+ GYTSRFGIVYVD+K LKRYPKMSAYWFK ++A Sbjct: 452 QLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKQLIA 511 Query: 183 RKK 191 +KK Sbjct: 512 KKK 514 >ref|XP_002533126.1| beta-glucosidase, putative [Ricinus communis] gi|223527070|gb|EEF29253.1| beta-glucosidase, putative [Ricinus communis] Length = 517 Score = 122 bits (305), Expect = 4e-26 Identities = 54/63 (85%), Positives = 59/63 (93%) Frame = +3 Query: 3 QLKKAIDDGANVIGYFAWSLLDNFEWKSGYTSRFGIVYVDYKDLKRYPKMSAYWFKTMLA 182 Q+KKAIDDGANV+GYFAWSL+DNFEW+SGYTSRFGIVYVD+ LKRYPKMSAYWFK ML Sbjct: 454 QMKKAIDDGANVVGYFAWSLVDNFEWRSGYTSRFGIVYVDFTTLKRYPKMSAYWFKQMLQ 513 Query: 183 RKK 191 RKK Sbjct: 514 RKK 516 >ref|XP_003534146.1| PREDICTED: beta-glucosidase 44-like [Glycine max] Length = 506 Score = 120 bits (302), Expect = 9e-26 Identities = 52/63 (82%), Positives = 59/63 (93%) Frame = +3 Query: 3 QLKKAIDDGANVIGYFAWSLLDNFEWKSGYTSRFGIVYVDYKDLKRYPKMSAYWFKTMLA 182 QLKKA+DDGANV+GYFAWSLLDNFEW+ GYTSRFGIVYVD+K LKRYPKMSAYWFK ++ Sbjct: 443 QLKKAVDDGANVVGYFAWSLLDNFEWRLGYTSRFGIVYVDFKTLKRYPKMSAYWFKQLIT 502 Query: 183 RKK 191 +KK Sbjct: 503 KKK 505