BLASTX nr result
ID: Coptis21_contig00031080
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00031080 (281 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004133817.1| PREDICTED: psbQ-like protein 1, chloroplasti... 64 1e-08 ref|XP_002890040.1| hypothetical protein ARALYDRAFT_471574 [Arab... 64 2e-08 ref|XP_002272064.1| PREDICTED: oxygen-evolving enhancer protein ... 62 5e-08 dbj|BAF01486.1| hypothetical protein [Arabidopsis thaliana] 60 1e-07 ref|NP_563937.1| photosystem II oxygen-evolving enhancer protein... 60 1e-07 >ref|XP_004133817.1| PREDICTED: psbQ-like protein 1, chloroplastic-like [Cucumis sativus] gi|449477919|ref|XP_004155162.1| PREDICTED: psbQ-like protein 1, chloroplastic-like [Cucumis sativus] Length = 187 Score = 64.3 bits (155), Expect = 1e-08 Identities = 29/32 (90%), Positives = 31/32 (96%) Frame = +1 Query: 1 LDYYVRTPKIYESYLYYEKTLKSLDDLVELLA 96 LDYYVRTPK+YESYLYYEKTLKS+DDLV LLA Sbjct: 156 LDYYVRTPKVYESYLYYEKTLKSIDDLVALLA 187 >ref|XP_002890040.1| hypothetical protein ARALYDRAFT_471574 [Arabidopsis lyrata subsp. lyrata] gi|297335882|gb|EFH66299.1| hypothetical protein ARALYDRAFT_471574 [Arabidopsis lyrata subsp. lyrata] Length = 189 Score = 63.5 bits (153), Expect = 2e-08 Identities = 28/32 (87%), Positives = 32/32 (100%) Frame = +1 Query: 1 LDYYVRTPKIYESYLYYEKTLKSLDDLVELLA 96 LDYYVRTPK+YESYLYYEKTLKS+D++VELLA Sbjct: 158 LDYYVRTPKVYESYLYYEKTLKSIDNVVELLA 189 >ref|XP_002272064.1| PREDICTED: oxygen-evolving enhancer protein 3-2, chloroplastic [Vitis vinifera] gi|296086349|emb|CBI31938.3| unnamed protein product [Vitis vinifera] Length = 188 Score = 62.0 bits (149), Expect = 5e-08 Identities = 27/31 (87%), Positives = 30/31 (96%) Frame = +1 Query: 4 DYYVRTPKIYESYLYYEKTLKSLDDLVELLA 96 DYYVRTPK+YESYLYYEKTLKS+DDLV +LA Sbjct: 158 DYYVRTPKVYESYLYYEKTLKSIDDLVAMLA 188 >dbj|BAF01486.1| hypothetical protein [Arabidopsis thaliana] Length = 182 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 1 LDYYVRTPKIYESYLYYEKTLKSLDDLVELLA 96 LD+YVRTPK+YESYLYYEKTLKS+D++VE LA Sbjct: 151 LDFYVRTPKVYESYLYYEKTLKSIDNVVEFLA 182 >ref|NP_563937.1| photosystem II oxygen-evolving enhancer protein [Arabidopsis thaliana] gi|75215661|sp|Q9XI73.1|PQL1_ARATH RecName: Full=PsbQ-like protein 1, chloroplastic; AltName: Full=Photosynthetic NDH subcomplex L 2; Flags: Precursor gi|5080787|gb|AAD39297.1|AC007576_20 Unknown protein [Arabidopsis thaliana] gi|13926216|gb|AAK49585.1|AF370579_1 Unknown protein [Arabidopsis thaliana] gi|21593897|gb|AAM65864.1| unknown [Arabidopsis thaliana] gi|24417380|gb|AAN60300.1| unknown [Arabidopsis thaliana] gi|332190991|gb|AEE29112.1| photosystem II oxygen-evolving enhancer protein [Arabidopsis thaliana] Length = 190 Score = 60.5 bits (145), Expect = 1e-07 Identities = 26/32 (81%), Positives = 31/32 (96%) Frame = +1 Query: 1 LDYYVRTPKIYESYLYYEKTLKSLDDLVELLA 96 LD+YVRTPK+YESYLYYEKTLKS+D++VE LA Sbjct: 159 LDFYVRTPKVYESYLYYEKTLKSIDNVVEFLA 190