BLASTX nr result
ID: Coptis21_contig00031071
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00031071 (590 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003526366.1| PREDICTED: phospholipid-transporting ATPase ... 57 2e-06 tpg|DAA54181.1| TPA: hypothetical protein ZEAMMB73_606269 [Zea m... 56 5e-06 tpg|DAA45138.1| TPA: hypothetical protein ZEAMMB73_278244 [Zea m... 56 5e-06 ref|XP_002271241.2| PREDICTED: phospholipid-transporting ATPase ... 56 5e-06 ref|XP_002457649.1| hypothetical protein SORBIDRAFT_03g011170 [S... 56 5e-06 >ref|XP_003526366.1| PREDICTED: phospholipid-transporting ATPase 1-like [Glycine max] Length = 1227 Score = 57.0 bits (136), Expect = 2e-06 Identities = 28/36 (77%), Positives = 31/36 (86%) Frame = -1 Query: 551 IALQVMIPISLYISMELVRLGWANFMIQDKDLYDES 444 I QVMIPISLYISMELVR+G A FMIQDK +YDE+ Sbjct: 453 IVFQVMIPISLYISMELVRVGQAYFMIQDKRMYDEA 488 >tpg|DAA54181.1| TPA: hypothetical protein ZEAMMB73_606269 [Zea mays] Length = 1178 Score = 55.8 bits (133), Expect = 5e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -1 Query: 551 IALQVMIPISLYISMELVRLGWANFMIQDKDLYDES 444 I QV+IPISLYISMELVRLG A FM DKDLYDES Sbjct: 409 IVYQVIIPISLYISMELVRLGQAYFMGADKDLYDES 444 >tpg|DAA45138.1| TPA: hypothetical protein ZEAMMB73_278244 [Zea mays] Length = 1122 Score = 55.8 bits (133), Expect = 5e-06 Identities = 28/36 (77%), Positives = 30/36 (83%) Frame = -1 Query: 551 IALQVMIPISLYISMELVRLGWANFMIQDKDLYDES 444 I Q+MIPISLYISMELVRLG A FMI+D LYDES Sbjct: 362 IVFQIMIPISLYISMELVRLGQAYFMIRDTRLYDES 397 >ref|XP_002271241.2| PREDICTED: phospholipid-transporting ATPase 1-like [Vitis vinifera] Length = 1227 Score = 55.8 bits (133), Expect = 5e-06 Identities = 27/36 (75%), Positives = 30/36 (83%) Frame = -1 Query: 551 IALQVMIPISLYISMELVRLGWANFMIQDKDLYDES 444 I Q+MIPISLYISMELVR+G A FMIQD LYDE+ Sbjct: 451 IVFQIMIPISLYISMELVRVGQAYFMIQDNKLYDEA 486 >ref|XP_002457649.1| hypothetical protein SORBIDRAFT_03g011170 [Sorghum bicolor] gi|241929624|gb|EES02769.1| hypothetical protein SORBIDRAFT_03g011170 [Sorghum bicolor] Length = 1180 Score = 55.8 bits (133), Expect = 5e-06 Identities = 29/36 (80%), Positives = 30/36 (83%) Frame = -1 Query: 551 IALQVMIPISLYISMELVRLGWANFMIQDKDLYDES 444 I QV+IPISLYISMELVRLG A FM DKDLYDES Sbjct: 411 IVYQVIIPISLYISMELVRLGQAYFMGADKDLYDES 446