BLASTX nr result
ID: Coptis21_contig00031011
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00031011 (292 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002511084.1| conserved hypothetical protein [Ricinus comm... 55 5e-06 >ref|XP_002511084.1| conserved hypothetical protein [Ricinus communis] gi|223550199|gb|EEF51686.1| conserved hypothetical protein [Ricinus communis] Length = 453 Score = 55.5 bits (132), Expect = 5e-06 Identities = 38/95 (40%), Positives = 53/95 (55%) Frame = -1 Query: 289 EEKRRAMKEFVGCLLEAKKRSKEPVTPRKFLVMEEDDAGEEKLLWDLLKNKNELPAQASP 110 E++ R MKE + L +A++ EP+TP K L MEE+ +EKLLW LLK K + QASP Sbjct: 327 EDRVRRMKEHLS-LPQAERGLIEPLTPHKLLGMEEEQVKDEKLLWKLLKKKRKY--QASP 383 Query: 109 FGAVGLPQAESNSKIRRHRGDIKISAKIEPVVSHR 5 G GL +S + + SA +P + HR Sbjct: 384 MGPEGLLCFDSYDRHGK-------SAGAKPPLDHR 411