BLASTX nr result
ID: Coptis21_contig00030147
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00030147 (285 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AEZ06398.1| EMF2-like protein, partial [Aquilegia coerulea] 61 1e-07 >gb|AEZ06398.1| EMF2-like protein, partial [Aquilegia coerulea] Length = 679 Score = 60.8 bits (146), Expect = 1e-07 Identities = 29/47 (61%), Positives = 34/47 (72%) Frame = -2 Query: 284 MIKLWNHSLLDSCTMDSCNKILVRYNTENLDSKHS*RRDYPHCNHGR 144 MIKLWNHSLLD CTMD CNKILV Y++E++D K RD + GR Sbjct: 628 MIKLWNHSLLDGCTMDICNKILVGYDSESIDCKQIEGRDCSLSSLGR 674