BLASTX nr result
ID: Coptis21_contig00030141
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00030141 (261 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_003628879.1| Pentatricopeptide repeat-containing protein ... 74 2e-11 emb|CBI35966.3| unnamed protein product [Vitis vinifera] 72 5e-11 ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containi... 71 8e-11 ref|XP_002263394.2| PREDICTED: pentatricopeptide repeat-containi... 69 3e-10 emb|CBI29077.3| unnamed protein product [Vitis vinifera] 69 3e-10 >ref|XP_003628879.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] gi|355522901|gb|AET03355.1| Pentatricopeptide repeat-containing protein [Medicago truncatula] Length = 633 Score = 73.6 bits (179), Expect = 2e-11 Identities = 35/87 (40%), Positives = 51/87 (58%), Gaps = 7/87 (8%) Frame = -3 Query: 259 FTWNSLFRT-----TPPHHALPLYTKMLQSNSHPNKFTFTFLLKACNK--ITKPYFAIHL 101 F WN++ + +PP H L+ ML S+ P+ FTF FLLKAC I+ P F + Sbjct: 81 FLWNAIIKAYSQIHSPPQHPFSLFKTMLNSSVLPDSFTFPFLLKACANVLISAPQFGFQV 140 Query: 100 HCHLIKFGFGSDAFLLSSLIGTYADAG 20 HCH+++ GFGSD F+ ++L+ Y G Sbjct: 141 HCHVLRNGFGSDVFVNNALLNFYCGFG 167 >emb|CBI35966.3| unnamed protein product [Vitis vinifera] Length = 624 Score = 72.0 bits (175), Expect = 5e-11 Identities = 35/80 (43%), Positives = 51/80 (63%), Gaps = 4/80 (5%) Frame = -3 Query: 259 FTWNSLFRTTP----PHHALPLYTKMLQSNSHPNKFTFTFLLKACNKITKPYFAIHLHCH 92 F+WNSL R P ++L LY KML+S++ P+ FTF F+LKAC+ + +H H Sbjct: 59 FSWNSLIRAYTVHGSPQNSLFLYLKMLRSSTKPSNFTFPFVLKACSTLGSVLEGEQIHTH 118 Query: 91 LIKFGFGSDAFLLSSLIGTY 32 +++ GFGSD F+ +SLI Y Sbjct: 119 VLRLGFGSDLFVCNSLIDMY 138 >ref|XP_004150015.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] gi|449529868|ref|XP_004171920.1| PREDICTED: pentatricopeptide repeat-containing protein At1g08070-like [Cucumis sativus] Length = 734 Score = 71.2 bits (173), Expect = 8e-11 Identities = 34/84 (40%), Positives = 49/84 (58%), Gaps = 4/84 (4%) Frame = -3 Query: 259 FTWNSLFR----TTPPHHALPLYTKMLQSNSHPNKFTFTFLLKACNKITKPYFAIHLHCH 92 F WNS+ R + P AL + +M+ S PN +TF FLLK+C K+ + +H H Sbjct: 95 FIWNSMIRGLSMSLSPALALVFFVRMIYSGVEPNSYTFPFLLKSCAKLASAHEGKQIHAH 154 Query: 91 LIKFGFGSDAFLLSSLIGTYADAG 20 ++K GF SD F+ +SLI YA +G Sbjct: 155 VLKLGFVSDVFIHTSLINMYAQSG 178 >ref|XP_002263394.2| PREDICTED: pentatricopeptide repeat-containing protein At2g29760, chloroplastic [Vitis vinifera] Length = 762 Score = 69.3 bits (168), Expect = 3e-10 Identities = 34/80 (42%), Positives = 52/80 (65%), Gaps = 4/80 (5%) Frame = -3 Query: 253 WNSLFR----TTPPHHALPLYTKMLQSNSHPNKFTFTFLLKACNKITKPYFAIHLHCHLI 86 +NSL R + P ALPLY MLQS P+ T+ F++KACN+ + +F + +H H++ Sbjct: 163 YNSLIRALSSSKTPLEALPLYHTMLQSGLKPDHMTYPFVIKACNESSVTWFGLLVHTHVV 222 Query: 85 KFGFGSDAFLLSSLIGTYAD 26 K GF D++++SSLI YA+ Sbjct: 223 KSGFECDSYIVSSLIHLYAN 242 >emb|CBI29077.3| unnamed protein product [Vitis vinifera] Length = 671 Score = 69.3 bits (168), Expect = 3e-10 Identities = 34/80 (42%), Positives = 52/80 (65%), Gaps = 4/80 (5%) Frame = -3 Query: 253 WNSLFR----TTPPHHALPLYTKMLQSNSHPNKFTFTFLLKACNKITKPYFAIHLHCHLI 86 +NSL R + P ALPLY MLQS P+ T+ F++KACN+ + +F + +H H++ Sbjct: 134 YNSLIRALSSSKTPLEALPLYHTMLQSGLKPDHMTYPFVIKACNESSVTWFGLLVHTHVV 193 Query: 85 KFGFGSDAFLLSSLIGTYAD 26 K GF D++++SSLI YA+ Sbjct: 194 KSGFECDSYIVSSLIHLYAN 213