BLASTX nr result
ID: Coptis21_contig00030129
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00030129 (504 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value emb|CAB42923.1| putative mitochondrial protein [Arabidopsis thal... 112 4e-23 ref|NP_190663.2| cytochrome BC1 synthesis-like protein [Arabidop... 112 4e-23 dbj|BAC41960.2| putative BCS1 protein [Arabidopsis thaliana] 110 9e-23 ref|XP_002269184.1| PREDICTED: uncharacterized protein LOC100241... 107 1e-21 ref|XP_002521535.1| Mitochondrial chaperone BCS1, putative [Rici... 106 2e-21 >emb|CAB42923.1| putative mitochondrial protein [Arabidopsis thaliana] Length = 480 Score = 112 bits (279), Expect = 4e-23 Identities = 53/77 (68%), Positives = 63/77 (81%) Frame = +3 Query: 3 ALLRPGRMDMHIHLSYCTPAVFKILASNYLQIQDHHLFENIENLIGNVEVTPAEVAEKLT 182 ALLRPGRMDMHIH+SYCTPA FK+LASNYL+IQDH LFE IE I +EVTPAEVAE+L Sbjct: 394 ALLRPGRMDMHIHMSYCTPAAFKVLASNYLEIQDHILFEQIEEFIREIEVTPAEVAEQLM 453 Query: 183 MNDEPDVVIQELLTYLE 233 +D D V+Q L+ +L+ Sbjct: 454 RSDSVDKVLQGLVEFLK 470 >ref|NP_190663.2| cytochrome BC1 synthesis-like protein [Arabidopsis thaliana] gi|109946623|gb|ABG48490.1| At3g50940 [Arabidopsis thaliana] gi|332645208|gb|AEE78729.1| cytochrome BC1 synthesis-like protein [Arabidopsis thaliana] Length = 451 Score = 112 bits (279), Expect = 4e-23 Identities = 53/77 (68%), Positives = 63/77 (81%) Frame = +3 Query: 3 ALLRPGRMDMHIHLSYCTPAVFKILASNYLQIQDHHLFENIENLIGNVEVTPAEVAEKLT 182 ALLRPGRMDMHIH+SYCTPA FK+LASNYL+IQDH LFE IE I +EVTPAEVAE+L Sbjct: 365 ALLRPGRMDMHIHMSYCTPAAFKVLASNYLEIQDHILFEQIEEFIREIEVTPAEVAEQLM 424 Query: 183 MNDEPDVVIQELLTYLE 233 +D D V+Q L+ +L+ Sbjct: 425 RSDSVDKVLQGLVEFLK 441 >dbj|BAC41960.2| putative BCS1 protein [Arabidopsis thaliana] Length = 451 Score = 110 bits (276), Expect = 9e-23 Identities = 52/77 (67%), Positives = 63/77 (81%) Frame = +3 Query: 3 ALLRPGRMDMHIHLSYCTPAVFKILASNYLQIQDHHLFENIENLIGNVEVTPAEVAEKLT 182 ALLRPGRMDMHIH+SYCTPA FK+LASNYL+IQDH LFE IE I +EVTP+EVAE+L Sbjct: 365 ALLRPGRMDMHIHMSYCTPAAFKVLASNYLEIQDHILFEQIEEFIREIEVTPSEVAEQLM 424 Query: 183 MNDEPDVVIQELLTYLE 233 +D D V+Q L+ +L+ Sbjct: 425 RSDSVDKVLQGLVEFLK 441 >ref|XP_002269184.1| PREDICTED: uncharacterized protein LOC100241950 [Vitis vinifera] gi|147815615|emb|CAN63838.1| hypothetical protein VITISV_041357 [Vitis vinifera] Length = 522 Score = 107 bits (266), Expect = 1e-21 Identities = 51/77 (66%), Positives = 62/77 (80%) Frame = +3 Query: 3 ALLRPGRMDMHIHLSYCTPAVFKILASNYLQIQDHHLFENIENLIGNVEVTPAEVAEKLT 182 ALLRPGRMDMHIH+SYCTP FKILA+NYL I +H+LF IENLI EVTPAEVAE L Sbjct: 378 ALLRPGRMDMHIHMSYCTPYGFKILAANYLGIINHYLFSYIENLIQTTEVTPAEVAEHLL 437 Query: 183 MNDEPDVVIQELLTYLE 233 +DEP+ +++L+ +LE Sbjct: 438 QSDEPEKALRDLIKFLE 454 >ref|XP_002521535.1| Mitochondrial chaperone BCS1, putative [Ricinus communis] gi|223539213|gb|EEF40806.1| Mitochondrial chaperone BCS1, putative [Ricinus communis] Length = 482 Score = 106 bits (265), Expect = 2e-21 Identities = 48/77 (62%), Positives = 64/77 (83%) Frame = +3 Query: 3 ALLRPGRMDMHIHLSYCTPAVFKILASNYLQIQDHHLFENIENLIGNVEVTPAEVAEKLT 182 ALLRPGRMDMHIH+SYCTP F+ILASNYL+I+DH LFE I+ LI + EVTPA +AE+L Sbjct: 371 ALLRPGRMDMHIHMSYCTPQGFRILASNYLEIKDHFLFEEIDGLIRSTEVTPASLAEELL 430 Query: 183 MNDEPDVVIQELLTYLE 233 +D+ D+ ++E+L +L+ Sbjct: 431 KSDDADLALEEVLNFLK 447