BLASTX nr result
ID: Coptis21_contig00030045
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00030045 (290 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_002527481.1| conserved hypothetical protein [Ricinus comm... 55 8e-06 >ref|XP_002527481.1| conserved hypothetical protein [Ricinus communis] gi|223533121|gb|EEF34879.1| conserved hypothetical protein [Ricinus communis] Length = 242 Score = 54.7 bits (130), Expect = 8e-06 Identities = 29/75 (38%), Positives = 44/75 (58%), Gaps = 2/75 (2%) Frame = -2 Query: 232 VCGFGFDADRREFKMVLVSFYKLNDG--EDVQSEVHVYTLGSDTWRKLIVSVPHLVFKAE 59 V GFGFD E+K+V V + +G D++ +V VY LG + WR +IVS +E Sbjct: 3 VLGFGFDPKSSEYKVVRVVYRMRENGCKVDIRPQVEVYELGMNAWRSIIVSAAPQYVISE 62 Query: 58 VAVSFEFANGSLHWI 14 +++ F NG++HWI Sbjct: 63 LSLQV-FLNGAVHWI 76