BLASTX nr result
ID: Coptis21_contig00030041
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00030041 (258 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value gb|AFW86835.1| hypothetical protein ZEAMMB73_214691 [Zea mays] 54 3e-13 ref|YP_588284.1| hypothetical protein ZeamMp020 [Zea mays subsp.... 62 6e-08 >gb|AFW86835.1| hypothetical protein ZEAMMB73_214691 [Zea mays] Length = 77 Score = 53.9 bits (128), Expect(2) = 3e-13 Identities = 24/27 (88%), Positives = 26/27 (96%) Frame = +1 Query: 124 SEPPIEASEVGEPYDGQLSPAVRRGLS 204 + PP+EASEVGEPYDGQLSPAVRRGLS Sbjct: 50 ASPPLEASEVGEPYDGQLSPAVRRGLS 76 Score = 45.8 bits (107), Expect(2) = 3e-13 Identities = 19/20 (95%), Positives = 19/20 (95%) Frame = +2 Query: 77 NPFVEPCIVSDPNLPGASPP 136 NPFV PCIVSDPNLPGASPP Sbjct: 34 NPFVGPCIVSDPNLPGASPP 53 >ref|YP_588284.1| hypothetical protein ZeamMp020 [Zea mays subsp. mays] gi|94502700|ref|YP_588308.1| hypothetical protein ZeamMp046 [Zea mays subsp. mays] gi|40795138|gb|AAR91182.1| hypothetical protein (mitochondrion) [Zea mays] gi|40795139|gb|AAR91183.1| hypothetical protein (mitochondrion) [Zea mays] Length = 99 Score = 61.6 bits (148), Expect = 6e-08 Identities = 37/63 (58%), Positives = 41/63 (65%), Gaps = 2/63 (3%) Frame = +1 Query: 25 VPFSSRQRGKESY*KRS*PLRRAVYCK*SEP--ARSEPPIEASEVGEPYDGQLSPAVRRG 198 VPFSSRQR + P C S+P + PP+EASEVGEPYDGQLSPAVRRG Sbjct: 40 VPFSSRQRKNHL---ENAPNPFVGPCIVSDPNLPGASPPLEASEVGEPYDGQLSPAVRRG 96 Query: 199 LSC 207 LSC Sbjct: 97 LSC 99