BLASTX nr result
ID: Coptis21_contig00029498
seq
BLASTX 2.2.25 [Feb-01-2011] Reference: Altschul, Stephen F., Thomas L. Madden, Alejandro A. Schaffer, Jinghui Zhang, Zheng Zhang, Webb Miller, and David J. Lipman (1997), "Gapped BLAST and PSI-BLAST: a new generation of protein database search programs", Nucleic Acids Res. 25:3389-3402. Query= Coptis21_contig00029498 (255 letters) Database: ./nr 23,641,837 sequences; 8,123,359,852 total letters Searching..................................................done Score E Sequences producing significant alignments: (bits) Value ref|XP_004160037.1| PREDICTED: uncharacterized protein LOC101225... 70 2e-10 ref|XP_004152696.1| PREDICTED: uncharacterized protein LOC101216... 70 2e-10 ref|XP_002510386.1| conserved hypothetical protein [Ricinus comm... 62 6e-08 gb|ACU16829.1| unknown [Glycine max] 60 2e-07 ref|NP_568612.1| uncharacterized protein [Arabidopsis thaliana] ... 59 5e-07 >ref|XP_004160037.1| PREDICTED: uncharacterized protein LOC101225525 [Cucumis sativus] Length = 231 Score = 70.1 bits (170), Expect = 2e-10 Identities = 38/74 (51%), Positives = 44/74 (59%), Gaps = 12/74 (16%) Frame = -3 Query: 187 SPPKQIPPNQHFH------------STRRSTVYLSLISLFPTLSLSPPAHAFSIGISGPK 44 SPP Q P N F ++RR LS IS P+L L PA AF IGISGPK Sbjct: 16 SPPSQSPNNDQFQECQPLRHQLPITTSRRGLTMLSFISAVPSLFLPAPASAFDIGISGPK 75 Query: 43 NWLREQKKKASRFL 2 +WL+EQKKKAS+FL Sbjct: 76 DWLKEQKKKASKFL 89 >ref|XP_004152696.1| PREDICTED: uncharacterized protein LOC101216764 [Cucumis sativus] Length = 231 Score = 70.1 bits (170), Expect = 2e-10 Identities = 38/74 (51%), Positives = 44/74 (59%), Gaps = 12/74 (16%) Frame = -3 Query: 187 SPPKQIPPNQHFH------------STRRSTVYLSLISLFPTLSLSPPAHAFSIGISGPK 44 SPP Q P N F ++RR LS IS P+L L PA AF IGISGPK Sbjct: 16 SPPSQSPNNDQFQECQPLRHQLPITTSRRGLTMLSFISAVPSLFLPAPASAFDIGISGPK 75 Query: 43 NWLREQKKKASRFL 2 +WL+EQKKKAS+FL Sbjct: 76 DWLKEQKKKASKFL 89 >ref|XP_002510386.1| conserved hypothetical protein [Ricinus communis] gi|223551087|gb|EEF52573.1| conserved hypothetical protein [Ricinus communis] Length = 243 Score = 61.6 bits (148), Expect = 6e-08 Identities = 29/48 (60%), Positives = 38/48 (79%) Frame = -3 Query: 145 TRRSTVYLSLISLFPTLSLSPPAHAFSIGISGPKNWLREQKKKASRFL 2 +RR LS+++L +LS PA AFSIGISGPK+WL+EQKKK+S+FL Sbjct: 43 SRRDAALLSVLALVSSLSQPAPATAFSIGISGPKDWLKEQKKKSSKFL 90 >gb|ACU16829.1| unknown [Glycine max] Length = 228 Score = 59.7 bits (143), Expect = 2e-07 Identities = 32/68 (47%), Positives = 44/68 (64%), Gaps = 1/68 (1%) Frame = -3 Query: 202 LTNKNSPPKQ-IPPNQHFHSTRRSTVYLSLISLFPTLSLSPPAHAFSIGISGPKNWLREQ 26 + + PPK+ + P+ +RR LS +SL SLS PA A IG+SGPKNWL++Q Sbjct: 22 IARSSLPPKRNVSPSPFSTLSRRGIALLSFLSL----SLSAPASAIEIGMSGPKNWLKDQ 77 Query: 25 KKKASRFL 2 KKKAS++L Sbjct: 78 KKKASKYL 85 >ref|NP_568612.1| uncharacterized protein [Arabidopsis thaliana] gi|332007476|gb|AED94859.1| uncharacterized protein [Arabidopsis thaliana] Length = 229 Score = 58.5 bits (140), Expect = 5e-07 Identities = 32/50 (64%), Positives = 38/50 (76%), Gaps = 1/50 (2%) Frame = -3 Query: 148 STRRSTVYLS-LISLFPTLSLSPPAHAFSIGISGPKNWLREQKKKASRFL 2 S R +TV LS SL TLS + PA AFS+GISGPK WL++QKKK+SRFL Sbjct: 38 SRRDATVLLSSATSLLLTLSPTNPAFAFSLGISGPKEWLKDQKKKSSRFL 87